DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and p4htma

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:401 Identity:73/401 - (18%)
Similarity:115/401 - (28%) Gaps:157/401 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LQVAAHNYTLSRHRDLFNPL----GAPRWQVYRDLGRTLLKLNRQCAYDAYESALRLNSQNVHLM 215
            |.:..|..|.|..:|:  ||    |:||                     |..:..:..|...||.
Zfish    61 LLLYVHYNTGSGEQDV--PLEKSAGSPR---------------------AVPAEHQTPSSTAHLS 102

  Fly   216 KE------------AGQMELFSL-RDPMEPILDLQPKPTVLEKYCRGEVPRHQGRLTCE------ 261
            .|            .|.::..|: .|....:..|..||.:.      |:|   |.|:.|      
Zfish   103 PEMSFQLPRLEGIRVGHVQRVSIVPDRTHNMRTLSLKPLLF------EIP---GFLSVEESNVVM 158

  Fly   262 ----LNDWVHSFLAYAPIKFEDLQQDPFIIL----YPGSIYEQEI-----------------RHV 301
                |....||.|...|.:.|.|.||....|    ..|.:..:||                 |.:
Zfish   159 QLAQLKGLTHSSLLTNPDQEEQLTQDELFSLLDLNQDGLLQREEILSLSHSTDGSWLSSYNLRKI 223

  Fly   302 ENAYERCPPN--DRFELK------LGISGCS-------------------ISDGYSPVLKRINER 339
            ....|..|..  ...|.|      |..||.:                   :.:|...:||.:..|
Zfish   224 HTGLETNPSGVLSLQEFKRVSGGVLRYSGAAQGLDGHTKVRQRSTHTRLYLGEGTHHLLKSVRNR 288

  Fly   340 ILDMAGVEKTW----DTFYIVEYAQ---------LAPFEPFKLFRNSTKFPKLNLMNFEDVEAK- 390
            :..:..:..:.    :...:|.|.|         .:|..|    .||.....|.......|..: 
Zfish   289 VTRLTRLPSSLVDLSEAMEVVRYEQGVFSHAHHDSSPTHP----DNSCTHTHLAANTSNQVACRY 349

  Fly   391 --VIIFLKDVTLGGAFTMP---------------------NGDILVQPKRGNVLITFENEEHSTT 432
              |:::|.....||..:.|                     .|::.|:|..|..|:.:.:      
Zfish   350 LTVLLYLNSADSGGETSFPVADNRTYEEEVLGDLSQQYCDKGNLKVKPVAGTALLWYNH------ 408

  Fly   433 ICPIIEGTGLV 443
               :.:|.|.|
Zfish   409 ---LSDGNGWV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 26/158 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583418
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.