DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:239 Identity:49/239 - (20%)
Similarity:84/239 - (35%) Gaps:72/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 DWVHS----FLA-YAPIKFEDLQQDPFIILYPGSIYEQEIR-HVENAYERCPPNDRFELKLGISG 322
            :|.|:    :|. :..:|.|.:...|.:::|......:::| |:|     ...:.:||.:|.:: 
 Worm     6 EWKHAVCFEYLQNFQIVKVEVVAWRPGLVIYRDLFTGKQVRDHLE-----LMEHLKFEEQLVVN- 64

  Fly   323 CSISDGYSPV--LKRINERIL---DMAGVEKTWDT---------FYIVEYAQLAPFEP------- 366
               .||...|  ::|.|...:   |.......|||         |...|......:.|       
 Worm    65 ---DDGNDIVSKIRRANGTQVFHEDHPAARSIWDTAKNLLPNLNFKTAEDILALSYNPGGHYAAH 126

  Fly   367 --FKLFR-----------NSTKFPKLNLMNFEDVEAKVIIFLKDVTLGGAFTMPNGDILVQPKRG 418
              :.|:.           |..:|..| :|.|...|:           |||...|.....|:.|.|
 Worm   127 HDYLLYPSEKEWDEWMRVNGNRFGTL-IMAFGAAES-----------GGATVFPRLGAAVRTKPG 179

  Fly   419 NVLITF------ENE---EHSTTICPIIEGTGLVMIKFIMKTDE 453
            :....|      |.|   ||:.  |||.:|...:...::...|:
 Worm   180 DAFFWFNAMGNSEQEDLSEHAG--CPIYKGQKQISTIWLRMRDQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 41/196 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167896
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.