DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and P4HTM

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:300 Identity:62/300 - (20%)
Similarity:97/300 - (32%) Gaps:92/300 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNLERNLLQNMRDYAEKLE----EKIDLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRHM 61
            |..|:|:.:....:|.|.:.    .::||..         :.|.|.|....|...|...||..  
Human   165 MKGLQRSQILPTEEYEEAMSTMQVSQLDLFR---------LLDQNRDGHLQLREVLAQTRLGN-- 218

  Fly    62 HQDWVGWQVYMEDLVAPEAVQKVESLLPQLPQKEAFRKAARSVHSLTQFYGYEPADLVAKDERSS 126
                 ||      .:.||::|::.:.:...|..:       .|.||.:|...:..|. .|..||.
Human   219 -----GW------WMTPESIQEMYAAIKADPDGD-------GVLSLQEFSNMDLRDF-HKYMRSH 264

  Fly   127 SLHLSPL--DCYHLGLELYEEQDYLGAAKWLQVAAHNYTLSRHR------------DLFNPLGAP 177
            ....|.|  :.:|..|       |.|     :.|.|.....|.|            :|..||...
Human   265 KAESSELVRNSHHTWL-------YQG-----EGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVV 317

  Fly   178 R------WQVYRDLG----RTLLKLNRQCAYDA--YESALRLNSQNVHLMKEAGQMELFSLRDPM 230
            |      :..:.|.|    .|:....:..|.::  :|::.|..|.|         ..|.|:..|.
Human   318 RYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPN---------WGLPSILRPG 373

  Fly   231 EPILDLQPKPTVLEKYCRGEVPRHQG---RLTCELNDWVH 267
            .|:...||        |...||...|   .....::.|.|
Human   374 TPMTQAQP--------CTVGVPLGMGPGDHWVIPVSPWEH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 25/121 (21%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:290234 19/88 (22%)
EFh 194..252 CDD:238008 17/86 (20%)
P4Hc 246..519 CDD:214780 39/189 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149300
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.