DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and PH4alphaSG2

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_651801.1 Gene:PH4alphaSG2 / 43623 FlyBaseID:FBgn0039779 Length:527 Species:Drosophila melanogaster


Alignment Length:520 Identity:122/520 - (23%)
Similarity:204/520 - (39%) Gaps:140/520 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNLERNLLQNMRDYAEKLEEKIDLINNYVEDYNVDIEDANED--PEKYLSNPLNSFRLIRHMHQ 63
            :..:|..||...|.|.|..::::|....|||....:.|.|...  .:.||.:||::||||:.:.:
  Fly    35 LAQVEEELLNATRSYVESQQKQLDFYRRYVEQIKREHEWATSQLKLDDYLGHPLHAFRLIKRLVR 99

  Fly    64 DWVGWQVYMEDLVAPEAVQKVESLLPQL------PQKEAFRKAARSVHSLTQFYGYEPADLVAKD 122
            ||.  .:..|.::|..|.::..:.:..|      |.:...:.|.:.:..|.:.|....:||.  |
  Fly   100 DWD--SLIFEPILANNAREEFRAFVEVLSRDLGYPDQSELQGAIKGLARLQKVYNLATSDLA--D 160

  Fly   123 ERSSSLH----LSPLDCYHLGLELYEEQDYLGAAKWLQVAAHNYTLSRHRDLFNPLGAPRWQVYR 183
            .....|:    |...:||.:|::|::..:|..:.:|||||   :.|.|:        :||.:  :
  Fly   161 GIIGGLNYGSDLRWRECYEIGVQLFDLGEYQRSLEWLQVA---FILLRN--------SPREE--K 212

  Fly   184 DLGRTLLKLNRQCAYDAYESALRLNSQNVHLMKEAGQMELFSLRDP------MEPILDLQPKPTV 242
            |.             |.|.|.:|          |...|..|.|.:|      :..||:.||..:.
  Fly   213 DA-------------DHYLSDIR----------EYASMANFELGNPKKAARLLSQILESQPTHSA 254

  Fly   243 --LEKYCRGEVPRH-----------------QGR----------LTCELNDWVHSFLAYAPIKFE 278
              .:||....||..                 |||          |.|.|:...|::...||::.|
  Fly   255 QQTQKYLESRVPGKNVQETKPSWFSNYTRLCQGRRLPEERSGDPLRCYLDGKRHAYFTLAPLQVE 319

  Fly   279 DLQQDPFIILYPGSIYEQEIRHVENAYERCPPNDRFEL---------------KLGISGCSISDG 328
            .:..||.|.:|.|.:..::|..:   :|..   |:.|:               .|.:|..:..|.
  Fly   320 PVHLDPDINVYHGMLSSKQILSI---FEEA---DKEEMVRSAVAGSGGEGTVRDLRVSQQTWLDY 378

  Fly   329 YSPVLKRINERI-----LDMAGVEKTWDTFYIVEYAQLAPFEP----FKLFRNSTKFPKLNLMNF 384
            .|||:..:...|     .||||.|.    ..:..|.....:||    |::     ..||    ||
  Fly   379 KSPVMNSVGRIIQFVSGFDMAGAEH----MQVANYGVGGQYEPHPDYFEV-----NLPK----NF 430

  Fly   385 E-DVEAKVIIFLKDVTLGGAFTMPNGDILVQPKRGNVLITFENEEHSTTI--------CPIIEGT 440
            | |..:..:.:|.||..||.......::.:.|.:| .|:.:.|...|..:        ||:|.|:
  Fly   431 EGDRISTSMFYLSDVEQGGYTVFTKLNVFLPPVKG-ALVMWHNLHRSLHVDARTLHAGCPVIVGS 494

  Fly   441  440
              Fly   495  494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 31/125 (25%)
PH4alphaSG2NP_651801.1 P4Ha_N 28..163 CDD:285528 33/131 (25%)
P4Hc 335..503 CDD:214780 40/180 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391515at2759
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.