DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and P4ha3

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_038938408.1 Gene:P4ha3 / 361612 RGDID:735150 Length:549 Species:Rattus norvegicus


Alignment Length:511 Identity:116/511 - (22%)
Similarity:192/511 - (37%) Gaps:127/511 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERNLLQNMRDYAEKLEEKI-DLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRHMHQDWVGW 68
            ||.||..:|.|....|.:: ||...|.:     :...:||.:..:.|||.:|.||:.:..|   |
  Rat    44 ERRLLGTLRRYLRGEEARLRDLTRFYDK-----VLSLHEDLKIPVVNPLLAFTLIKRLQSD---W 100

  Fly    69 QVYMEDLVAPEAV-------QKVESLLPQLPQKEAFRKAARSVHSLTQFY--------------- 111
            :..:..|.|.|.:       :|||.   .||..|....|||::..|...|               
  Rat   101 RNVVHSLEATENIRALKDGYEKVEQ---DLPAFEDLEGAARALMRLQDVYMLNVKGLAQGVFQRV 162

  Fly   112 -GYEPADLVAKDERSSSLHLSPLDCYHLGLELYEEQDYLGAAKWLQVA----------------- 158
             |....||.:..:..|   |:..||:.:|...|:..||..|..||:.|                 
  Rat   163 TGSSITDLYSPRQLFS---LTADDCFQVGKVAYDTGDYYHAIPWLEEAVSLFRRSYGEWKTEDEA 224

  Fly   159 ----AHNY---------------TLSRHRDLFNPLGAPRWQVYRDLGRTLLKLNRQCAYDAYESA 204
                |.:|               :|||...:::|..       :.:.|.:||         ||  
  Rat   225 SLEDALDYLAFACYQVGNVSCALSLSREFLVYSPDN-------KRMARNVLK---------YE-- 271

  Fly   205 LRLNSQNVHLMKEAGQMELFSLRDPMEPILDLQPKPTVLEKYCR--GEVPRHQ--GRLTCELNDW 265
             ||.::|.|||  |.:.   :::.|..|  .||.:.| .|..|:  |..|.|.  ..|.|.....
  Rat   272 -RLLAENGHLM--AAET---AIQRPNVP--HLQTRDT-YEGLCQTLGSQPTHYQIPSLYCSYETN 327

  Fly   266 VHSFLAYAPIKFEDLQQDPFIILYPGSIYEQEIRHVENAYER-------CPPNDRFELKLGISGC 323
            ...:|...|.:.|.:...|.:.||...:.::|.:.:....|.       .....:.:::..||..
  Rat   328 SSPYLLLQPARKEVIHLRPLVALYHDFVSDEEAQKIRELAEPWLQRSVVASGEKQLQVEYRISKS 392

  Fly   324 S-ISDGYSPVLKRINERILDMAGVE---KTWDTFYIVEYAQLAPFEPFKLFRNSTKFPKLNLMNF 384
            : :.|...|||..::.||..:.|::   ...:...:|.|.....:||......|...|...:.:.
  Rat   393 AWLKDTVDPVLVTLDRRIAALTGLDIQPPYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYKMKSG 457

  Fly   385 EDVEAKVIIFLKDVTLGGA-------FTMPNGDILVQPKRGNVLITFENEEHSTTI 433
            ..| |.::|:|..|..|||       |::|   ::..|..|...:...:|:.:..|
  Rat   458 NRV-ATLMIYLSSVEAGGATAFIYGNFSVP---VVKWPTSGYTSMDRNSEDPAAPI 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 36/137 (26%)
P4ha3XP_038938408.1 P4Ha_N 34..108 CDD:400573 20/71 (28%)
P4Hc 356..>478 CDD:214780 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343147
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.