DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and P4htm

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:446 Identity:70/446 - (15%)
Similarity:135/446 - (30%) Gaps:171/446 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DANEDP----EKYLSNPLNSFRLIRHMHQDWVGWQVYMEDLVAPEAVQKVESLLPQLPQKEAF-- 97
            |.:.||    .:....|:.:...:..:....||::..::.:...:...:..||.|.|.:...|  
  Rat    89 DESTDPGPQRREQSPQPVPTLGPLTRLEGIKVGYERKVQVVAGRDHFIRTLSLKPLLFEIPGFLS 153

  Fly    98 RKAARSVHSLTQFYGYEPADLVAK---DERSSSLHLSPLDCYHLGLELYEEQDYLGAAKWLQVAA 159
            .:..|.:..|.|..|.:.:.::..   :|..|::.:|.||.:.|     .:|::.|..:..:|.|
  Rat   154 DEECRLIIHLAQMKGLQRSQILPTEEYEEAMSAMRVSQLDLFQL-----LDQNHDGRLQLREVLA 213

  Fly   160 HNYTLSRHRDLFNPLGAPRWQVYRDLGRTLLKLNRQCAYDAYESALRLNSQNVHLMKEAGQMELF 224
            .           ..||..||         :...|.|..|.|.::  ..:...|..::|...|:  
  Rat   214 Q-----------TRLGNGRW---------MTPENIQEMYSAIKA--DPDGDGVLSLQEFSNMD-- 254

  Fly   225 SLRDPMEPILDLQPKPTVLEKYCRGEVPRHQGRLTCELNDWVHSFLAYAPIKFEDLQQDPFIILY 289
             |||              ..||.|.........:....:.|:|.                     
  Rat   255 -LRD--------------FHKYMRSHKAESSELVRNSHHTWLHQ--------------------- 283

  Fly   290 PGSIYEQEIRHVENAYERCPPNDRFELKLGISGCSISDGYSPVLKRINERILDMAGVEKTWDTFY 354
                                                .:|...|::.|.:|:|.:..:...     
  Rat   284 ------------------------------------GEGAHHVMRAIRQRVLRLTRLSPE----- 307

  Fly   355 IVEYAQLAPFEPFKLFR------------NSTKFPK-----LNLMNFEDVEAK-------VIIFL 395
            |||.:     ||.::.|            :...:|:     ..|:..|.|..:       |:.:|
  Rat   308 IVELS-----EPLQVVRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPFETSCRYMTVLFYL 367

  Fly   396 KDVTLGGAFTMP---------------------------NGDILVQPKRGNVLITF 424
            .:||.||....|                           .|::.|:|::|..:..:
  Rat   368 NNVTGGGETVFPVADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWY 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 15/85 (18%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 16/86 (19%)
P4Hc 247..459 CDD:214780 36/261 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.