DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and P4HA3

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001275677.1 Gene:P4HA3 / 283208 HGNCID:30135 Length:604 Species:Homo sapiens


Alignment Length:475 Identity:106/475 - (22%)
Similarity:172/475 - (36%) Gaps:119/475 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERNLLQNMRDYAEKLEEKI-DLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRHMHQDWVGW 68
            ||.||..:|.|....|.:: ||...|.:     :...:||....::|||.:|.||:.:..|   |
Human    44 ERRLLGLLRRYLRGEEARLRDLTRFYDK-----VLSLHEDSTTPVANPLLAFTLIKRLQSD---W 100

  Fly    69 QVYMEDLVAPEAV-------QKVESLLPQLPQKEAFRKAARSVHSLTQFY--------------- 111
            :..:..|.|.|.:       :|||.   .||..|....|||::..|...|               
Human   101 RNVVHSLEASENIRALKDGYEKVEQ---DLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRV 162

  Fly   112 -GYEPADLVAKDERSSSLHLSPLDCYHLGLELYEEQDYLGAAKWLQVAAHNY------------- 162
             |....||.:.....|   |:..||:.:|...|:..||..|..||:.|...:             
Human   163 TGSAITDLYSPKRLFS---LTGDDCFQVGKVAYDMGDYYHAIPWLEEAVSLFRGSYGEWKTEDEA 224

  Fly   163 -----------------------TLSRHRDLFNPLGAPRWQVYRDLGRTLLKLNRQCAYDAYESA 204
                                   :|||...|::|..       :.:.|.:||..|          
Human   225 SLEDALDHLAFAYFRAGNVSCALSLSREFLLYSPDN-------KRMARNVLKYER---------- 272

  Fly   205 LRLNSQNVHLMKEA----GQMELFSLRDPMEPILD-LQPKPTVLEKYCRGEVPRHQGRLTCELND 264
            |...|.| |::.||    ..:.....||..|.:.. |..:||:.      ::|    .|.|....
Human   273 LLAESPN-HVVAEAVIQRPNIPHLQTRDTYEGLCQTLGSQPTLY------QIP----SLYCSYET 326

  Fly   265 WVHSFLAYAPIKFEDLQQDPFIILYPGSIYEQEIRHVENAYER-------CPPNDRFELKLGISG 322
            ..:::|...||:.|.:..:|:|.||...:.:.|.:.:....|.       .....:.:::..||.
Human   327 NSNAYLLLQPIRKEVIHLEPYIALYHDFVSDSEAQKIRELAEPWLQRSVVASGEKQLQVEYRISK 391

  Fly   323 CS-ISDGYSPVLKRINERILDMAGVE---KTWDTFYIVEYAQLAPFEPFKLFRNSTKFPKLNLMN 383
            .: :.|...|.|..:|.||..:.|::   ...:...:|.|.....:||......|...|...:.:
Human   392 SAWLKDTVDPKLVTLNHRIAALTGLDVRPPYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYRMKS 456

  Fly   384 FEDVEAKVIIFLKDVTLGGA 403
            ...| |..:|:|..|..|||
Human   457 GNRV-ATFMIYLSSVEAGGA 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 36/137 (26%)
P4HA3NP_001275677.1 P4Ha_N 58..159 CDD:285528 28/111 (25%)
TPR_12 186..252 CDD:290160 10/65 (15%)
P4Hc 356..>478 CDD:214780 25/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149272
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.