DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and phy-3

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_507251.2 Gene:phy-3 / 188624 WormBaseID:WBGene00004026 Length:318 Species:Caenorhabditis elegans


Alignment Length:225 Identity:41/225 - (18%)
Similarity:75/225 - (33%) Gaps:75/225 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 WVHSFLAYAPIKFEDLQQDPFIILYPG-----------SIYEQ---EIR-------HVENAYERC 308
            :|::.|   |:..|.:...|.:::|..           :..||   ||:       .:|..:.|.
 Worm    76 YVYNML---PVDMEIISWAPTLVIYRNLMSPRQTASFLNFIEQRDLEIQKTSDFGTSIETTHRRA 137

  Fly   309 -----PPND---RFELKLGISGCSISDGYSPVLKRINERILDMAGVEKTWDTFYIVEYAQLAPFE 365
                 ||.|   ..|:|:            ...|||       .|:..|     :.|:.....:.
 Worm   138 NGSFIPPEDSNVTVEIKM------------QAQKRI-------PGLNLT-----VAEHFSALSYL 178

  Fly   366 PFKLFRNSTKFPKLNLMNFEDVE----------AKVIIFLKDVTLGGAFTMPNGDILVQPKRGNV 420
            |...:  :..:..|:..:.:|.:          ..:|..||....||....|:....|:...|:.
 Worm   179 PGGHY--AVHYDYLDYRSKQDYDWWMNKTGNRIGTLIFVLKPAEKGGGTVFPSIGSTVRANAGDA 241

  Fly   421 LITF--ENEEHSTTI-----CPIIEGTGLV 443
            ...|  :.:|....:     |||.||..::
 Worm   242 FFWFNAQADEEKEMLSNHGGCPIYEGRKVI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
phy-3NP_507251.2 P4Hc 102..277 CDD:214780 35/196 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167898
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.790

Return to query results.
Submit another query.