DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2246 and PRS3

DIOPT Version :9

Sequence 1:NP_001189321.1 Gene:CG2246 / 43637 FlyBaseID:FBgn0039790 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_011852.1 Gene:PRS3 / 856375 SGDID:S000001003 Length:320 Species:Saccharomyces cerevisiae


Alignment Length:381 Identity:141/381 - (37%)
Similarity:210/381 - (55%) Gaps:65/381 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TSDIVIINGNSHPDLANMVAERMGIKNGGCSVFHKSNRETIVEISDSVRGKDIYII-QTGTKDAN 89
            |:.|.::..:.|..||.:||:|:|::.....:......|....|.:|||.:||:|| |.|:...|
Yeast     3 TNSIKLLAPDVHRGLAELVAKRLGLQLTSSKLKRDPTGEVSFSIGESVRDQDIFIITQIGSGVVN 67

  Fly    90 NNIMELLIMAYACKTSSARSIVGVIPYLPYSKQ-CKMRKRGCIVSKLLAKMMCTSGLTHIITMDL 153
            :.::|||||..|.||:|||.|..:||..||::| .|.:.|..|.:||:|.|:.|:|..|:|||||
Yeast    68 DRVLELLIMINASKTASARRITAIIPNFPYARQDRKDKSRAPITAKLMADMLTTAGCDHVITMDL 132

  Fly   154 HQKEIQGFFDIPVDNLRASPFLLQYIQESIPDYRNSVIVARNPGVAKKANSYAERLRLGLAVIHG 218
            |..:||||||:|||||.|.|.:::||:|:: :|.:|:|::.:.|.||:|.:.|:||.|..|:||.
Yeast   133 HASQIQGFFDVPVDNLYAEPSVVRYIKENV-NYMDSIIISPDAGGAKRAATLADRLDLNFALIHK 196

  Fly   219 EQKETDADEVDGRYSPPPTSAYSNLLGNSVEMCLPATPRNSTPQHAPTSSARQRTTSVSVGVPEH 283
            |                                                  |.|...||      
Yeast   197 E--------------------------------------------------RARANEVS------ 205

  Fly   284 IVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKENGACKIYVLATHGLLSSDAPRQLD 348
                  .:.:||||:.:|.|:|||:.|.......|||:|.||.|..:..:.|||:||..|...::
Yeast   206 ------RMVLVGDVTDKICIIVDDMADTCGTLAKAAEILLENRAKSVIAIVTHGVLSGRAIENIN 264

  Fly   349 ESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAEAIRRIHNKESMSYLFRNVTL 404
            .|.:|.:|.|||:|.|.:..:|.|:..||||.::||:|||:||.||:||||:|..|
Yeast   265 NSKLDRVVCTNTVPFEEKIKKCPKLAVIDISSVLAESIRRLHNGESISYLFKNYPL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2246NP_001189321.1 PrsA 25..400 CDD:223538 138/375 (37%)
Pribosyltran_N 29..144 CDD:290508 45/116 (39%)
Pribosyl_synth 185..400 CDD:291252 68/214 (32%)
PRS3NP_011852.1 PrsA 4..315 CDD:223538 136/373 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60704
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.