DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2246 and PRS2

DIOPT Version :9

Sequence 1:NP_001189321.1 Gene:CG2246 / 43637 FlyBaseID:FBgn0039790 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_174516.1 Gene:PRS2 / 840131 AraportID:AT1G32380 Length:400 Species:Arabidopsis thaliana


Alignment Length:405 Identity:107/405 - (26%)
Similarity:188/405 - (46%) Gaps:77/405 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GSVRPP-------------KRCRSDMDNTSTSDIVIINGNSHPDLANMVAERMGIKNGGCSVFHK 60
            |:.|.|             .|....:...:|. :.:.:|.::|.|:..:|..||::.|..|:...
plant    58 GNARVPIINETTIPKFFDSSRLEKSVSRNNTK-LKLFSGTANPALSQEIAWYMGLELGKVSIKRF 121

  Fly    61 SNRETIVEISDSVRGKDIYIIQTGTKDANNNIMELLIMAYACKTSSARSIVGVIPYLPYSK-QCK 124
            ::.|..|::.:||||.|::::|......|.|:||||||..||:.:||:.:..||||..|:: ..|
plant   122 ADGEIYVQLKESVRGCDVFLVQPTCTPTNENLMELLIMVDACRRASAKKVTAVIPYFGYARADRK 186

  Fly   125 MRKRGCIVSKLLAKMMCTSGLTHIITMDLHQKEIQGFFDIPVDNLRASPFLLQYIQESIPDYRNS 189
            .:.|..|.:||:|.::..:|...::..|||..:..|:||||||::...|.:|.|:........:.
plant   187 TQGRESIAAKLVANLITEAGADRVLACDLHSGQSMGYFDIPVDHVYCQPVILDYLASKSISSEDL 251

  Fly   190 VIVARNPGVAKKANSYAERLRLGLAVIHGEQKETDADEVDGRYSPPPTSAYSNLLGNSVEMCLPA 254
            |:|:.:.|...:|.::|::|                                             
plant   252 VVVSPDVGGVARARAFAKKL--------------------------------------------- 271

  Fly   255 TPRNSTPQHAPTSSARQRTTSVSVGVPEHIVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAA 319
                   ..||.:...:|         .|...|...:.::|||.|::|:||||:||.....|..|
plant   272 -------SDAPLAIVDKR---------RHGHNVAEVMNLIGDVKGKVAVMVDDIIDTAGTIVKGA 320

  Fly   320 EMLKENGACKIYVLATHGLLSSDAPRQLDESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAE 384
            .:|.|.||.::|...||.:.|..|..:|....:.|::||||:| ..:|....::..:.::.|:.|
plant   321 ALLHEEGAREVYACCTHAVFSPPAIERLSSGLLQEVIVTNTLP-VAEKNYFPQLTILSVANLLGE 384

  Fly   385 AIRRIHNKESMSYLF 399
            .|.|:|:..|:|.:|
plant   385 TIWRVHDDSSVSSIF 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2246NP_001189321.1 PrsA 25..400 CDD:223538 103/376 (27%)
Pribosyltran_N 29..144 CDD:290508 39/115 (34%)
Pribosyl_synth 185..400 CDD:291252 49/215 (23%)
PRS2NP_174516.1 PLN02369 99..400 CDD:215209 101/363 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 95 1.000 Domainoid score I2493
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 262 1.000 Inparanoid score I963
OMA 1 1.010 - - QHG60704
OrthoDB 1 1.010 - - D1043963at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.