DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2246 and PRS3

DIOPT Version :9

Sequence 1:NP_001189321.1 Gene:CG2246 / 43637 FlyBaseID:FBgn0039790 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_172540.1 Gene:PRS3 / 837613 AraportID:AT1G10700 Length:411 Species:Arabidopsis thaliana


Alignment Length:365 Identity:75/365 - (20%)
Similarity:127/365 - (34%) Gaps:112/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MDNTSTSD-IVIINGNS------------------------HPDLANMVAERMGIKNGGCSVFHK 60
            :|..|..| |.:||.||                        |.|....:|||: :....|.....
plant    64 LDFLSNGDPISLINPNSSSPITMAAATSESGSKSSKRVCLFHSDETRDLAERI-VAKSDCIELRS 127

  Fly    61 SN--------RETIVEISDSVRGKDIYIIQTGTKDANNNIMELLIMAYACKTSSARSIVGVIPYL 117
            .|        ....::.:..:||:.:..:.:.:..|  .|.|.|.:.||.......|...|:|:.
plant   128 INWKKFDDGFPNLFIQNAQGIRGQHVAFLASFSSPA--VIFEQLSVIYALPKLFVSSFTLVLPFF 190

  Fly   118 PYSKQCKMRKRGCIVSKL-LAKMMCT-----SGLTHIITMDLHQKEIQGFF-DIPVDNLRASPFL 175
            |.....:|...|.:.:.. ||:::..     .|.|.::|.|:|..:.:.:| |..:....:...|
plant   191 PTGTSERMEDEGDVATAFTLARILSNIPTSRGGPTSLVTFDIHALQERFYFGDTILPCFESGIPL 255

  Fly   176 LQYIQESIPDYRNSVIVARNPGVAKKANSYAERLRLGLAVIHGEQKETDADEVDGRYSPPPTSAY 240
            |:...:|:||..|..|...:.|..|:   :.::|                               
plant   256 LKSRLQSLPDSDNISIAFPDDGAWKR---FHKQL------------------------------- 286

  Fly   241 SNLLGNSVEMCLPATPRNSTPQHAPTSSARQRTTSVSVGVPEHIVKVKPPLTIVGDVSGRIAIMV 305
                                 ||.||....:    |.:| .:.||::|.     ||..||..::|
plant   287 ---------------------QHYPTIVCNK----VRMG-DKRIVRIKE-----GDAEGRHVVIV 320

  Fly   306 DDLIDDVQAFVAAAEMLKENGACKIYVLATHGLLSSDAPR 345
            |||:......:...::|..:||.||....|||:.    ||
plant   321 DDLVQSGGTLIECQKVLAAHGAAKISAYVTHGIF----PR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2246NP_001189321.1 PrsA 25..400 CDD:223538 74/361 (20%)
Pribosyltran_N 29..144 CDD:290508 28/152 (18%)
Pribosyl_synth 185..400 CDD:291252 33/161 (20%)
PRS3NP_172540.1 PLN02297 85..411 CDD:177934 67/344 (19%)
PRTases_typeI <295..367 CDD:206754 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.