DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2246 and AT2G42910

DIOPT Version :9

Sequence 1:NP_001189321.1 Gene:CG2246 / 43637 FlyBaseID:FBgn0039790 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_181819.1 Gene:AT2G42910 / 818892 AraportID:AT2G42910 Length:337 Species:Arabidopsis thaliana


Alignment Length:321 Identity:56/321 - (17%)
Similarity:108/321 - (33%) Gaps:93/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VRGKDIYIIQTGTKDANNNIMELLIMAYACKTSSARSIVGVIPYLPYSKQCKMRKRGCIVSKL-L 136
            :||:.:..:.:.:..|  .|.|.:.:.|........|...|:|:.|.....:|.:.|.:.:.. :
plant    75 IRGQHVAFLASFSSPA--VIFEQISVIYLLPRLFVASFTLVLPFFPTGSFERMEEEGDVATAFTM 137

  Fly   137 AKMMCT-----SGLTHIITMDLHQKEIQGFFDIPVDNL--RASPFLLQYIQESIPDYRNSVIVAR 194
            |:::..     .|.|.::..|:|..:.:.:|...|..|  ...|.|.:.:|: :|:....::...
plant   138 ARIVSNIPISRGGPTSVVIYDIHALQERFYFADQVLPLFETGIPLLTKRLQQ-LPETEKVIVAFP 201

  Fly   195 NPGVAKKANSYAERLRLGLAVIHGEQKETDADEVDGRYSPPPTSAYSNLLGNSVEMCLPATPRNS 259
            :.|..|:                                      :..||               
plant   202 DDGAWKR--------------------------------------FHKLL--------------- 213

  Fly   260 TPQHAPTSSARQRTTSVSVGVPEHIVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKE 324
              .|.||...    |.|..| .:.||::|.     |:.:|...::||||:......:...::|..
plant   214 --DHYPTVVC----TKVREG-DKRIVRLKE-----GNPAGCHVVIVDDLVQSGGTLIECQKVLAA 266

  Fly   325 NGACKIYVLATHGLLSSDAPRQL-----------------DESPIDEIVVTNTIPHEIQKL 368
            :||.|:....|||:....:..:.                 |..|.....:.|..|.|:..|
plant   267 HGAVKVSAYVTHGVFPKSSWERFTHKKNGLEEAFAYFWITDSCPQTVKAIGNKAPFEVLSL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2246NP_001189321.1 PrsA 25..400 CDD:223538 56/321 (17%)
Pribosyltran_N 29..144 CDD:290508 13/76 (17%)
Pribosyl_synth 185..400 CDD:291252 32/201 (16%)
AT2G42910NP_181819.1 PLN02297 12..337 CDD:177934 56/321 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.