DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2246 and prpsap1

DIOPT Version :9

Sequence 1:NP_001189321.1 Gene:CG2246 / 43637 FlyBaseID:FBgn0039790 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001002199.1 Gene:prpsap1 / 431746 ZFINID:ZDB-GENE-040704-40 Length:353 Species:Danio rerio


Alignment Length:387 Identity:232/387 - (59%)
Similarity:289/387 - (74%) Gaps:38/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NTSTSDIVIINGNSHP---DLANMVAERMGIKNGGCSVFHKSNRETIVEISDSVRGKDIYIIQTG 84
            |.:.|...:.:.||.|   :|:..:.||:|::.|...|:.:|||||.|||.:||||:.|:||||.
Zfish     2 NVAKSGYRVFSANSTPACTELSKKITERLGVELGKSVVYQESNRETRVEIKESVRGQTIFIIQTI 66

  Fly    85 TKDANNNIMELLIMAYACKTSSARSIVGVIPYLPYSKQCKMRKRGCIVSKLLAKMMCTSGLTHII 149
            .:|.|..||||||||||.|||.|::|:|||||.||||||||||||.||.||||.|:..:||||||
Zfish    67 PRDVNTAIMELLIMAYALKTSCAKNIIGVIPYFPYSKQCKMRKRGSIVCKLLASMLAKAGLTHII 131

  Fly   150 TMDLHQKEIQGFFDIPVDNLRASPFLLQYIQESIPDYRNSVIVARNPGVAKKANSYAERLRLGLA 214
            |||||||||||||..|||||||||||||||||.||||||::|||::|..||:|.|||||||||||
Zfish   132 TMDLHQKEIQGFFTFPVDNLRASPFLLQYIQEEIPDYRNAIIVAKSPSAAKRAQSYAERLRLGLA 196

  Fly   215 VIHGEQKETDADEVDGRYSPPPTSAYSNLLGNSVEMCLPATPRNSTPQHAPTSSARQRTTSVSVG 279
            ||||   |.::|..|||:|||   ...|.:|:.                             .:.
Zfish   197 VIHG---EAESDMADGRHSPP---CVRNTIGHP-----------------------------GLE 226

  Fly   280 VPEHIVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKENGACKIYVLATHGLLSSDAP 344
            :|..:.|.|||:|:||||.|||||:|||:||||:.:|||||:|||.||.|||::|||||||:|||
Zfish   227 LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVEDYVAAAEILKERGAYKIYIMATHGLLSADAP 291

  Fly   345 RQLDESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAEAIRRIHNKESMSYLFRNVTLED 406
            |.::||.|||:|||||:|||:|||||.||||:|:|:::|||||||||.|||:|||||:|::|
Zfish   292 RLIEESAIDEVVVTNTVPHEVQKLQCPKIKTVDVSMILAEAIRRIHNGESMAYLFRNITVDD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2246NP_001189321.1 PrsA 25..400 CDD:223538 226/377 (60%)
Pribosyltran_N 29..144 CDD:290508 67/117 (57%)
Pribosyl_synth 185..400 CDD:291252 120/214 (56%)
prpsap1NP_001002199.1 PrsA 6..347 CDD:223538 226/375 (60%)
Pribosyltran_N 9..126 CDD:290508 67/116 (58%)
Pribosyl_synth 167..347 CDD:291252 120/214 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581576
Domainoid 1 1.000 242 1.000 Domainoid score I2185
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1043963at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.