DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2246 and Pdha1

DIOPT Version :10

Sequence 1:NP_733389.2 Gene:CG2246 / 43637 FlyBaseID:FBgn0039790 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001004072.2 Gene:Pdha1 / 29554 RGDID:3286 Length:390 Species:Rattus norvegicus


Alignment Length:86 Identity:22/86 - (25%)
Similarity:35/86 - (40%) Gaps:27/86 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 VSVGVPEHIVKVK---PPLTIVGD--VSGRIAIMVDDL----------IDDVQAFVAA--AEMLK 323
            ||....|.|.:|:   .|:.::.|  |:..:| .|::|          |:|...|..|  ...|:
  Rat   299 VSYRTREEIQEVRSKSDPIMLLKDRMVNSNLA-SVEELKEIDVEVRKEIEDAAQFATADPEPPLE 362

  Fly   324 ENGACKIYVLATHGLLSSDAP 344
            |.|         :.:.|||.|
  Rat   363 ELG---------YHIYSSDPP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2246NP_733389.2 Pribosyltran_N 29..144 CDD:433483
Pribosyl_synth 185..400 CDD:434046 22/86 (26%)
Pdha1NP_001004072.2 PDH_E1_alph_y 58..370 CDD:274473 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.