DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2246 and SPCC1620.06c

DIOPT Version :9

Sequence 1:NP_001189321.1 Gene:CG2246 / 43637 FlyBaseID:FBgn0039790 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_588464.1 Gene:SPCC1620.06c / 2538924 PomBaseID:SPCC1620.06c Length:321 Species:Schizosaccharomyces pombe


Alignment Length:377 Identity:155/377 - (41%)
Similarity:223/377 - (59%) Gaps:64/377 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STSDIVIINGNSHPDLANMVAERMGIKNGGCSVFHKSNRETIVEISDSVRGKDIYIIQTGTKDAN 89
            :::.|.|..|||||:||..||.|:|:..|..:|...|||||.|.|.:|||.:|::|:|||....|
pombe     2 ASNSIKIFAGNSHPELAEKVARRIGLSLGKVAVVQYSNRETSVTIGESVRDEDVFILQTGCGSIN 66

  Fly    90 NNIMELLIMAYACKTSSARSIVGVIPYLPYSKQCKMRK-RGCIVSKLLAKMMCTSGLTHIITMDL 153
            :::||||||..||:::|||.|..:||..||::|.|..| |..|.::|:|.|:.|:|..|||||||
pombe    67 DHLMELLIMINACRSASARRITAIIPCFPYARQDKKDKSRAPITARLVANMLQTAGCNHIITMDL 131

  Fly   154 HQKEIQGFFDIPVDNLRASPFLLQYIQESIPDYRN-SVIVARNPGVAKKANSYAERLRLGLAVIH 217
            |..:|||||::|||||.|.|.:|:||:|:|....| :|||:.:.|.||:|.:.|:||.|..|:||
pombe   132 HASQIQGFFNVPVDNLYAEPSVLRYIRENIDTTVNPTVIVSPDAGGAKRATALADRLDLDFALIH 196

  Fly   218 GEQKETDADEVDGRYSPPPTSAYSNLLGNSVEMCLPATPRNSTPQHAPTSSARQRTTSVSVGVPE 282
            .|                                                  ||:...||     
pombe   197 KE--------------------------------------------------RQKANEVS----- 206

  Fly   283 HIVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKENGACKIYVLATHGLLSSDAPRQL 347
                   .:.:||||..::||:|||:.|.......||:.||:|||..:|.:.|||:||..|.:.:
pombe   207 -------RMVLVGDVRDKLAILVDDMADTCGTLGLAAKTLKDNGAKAVYAIVTHGILSGKAIKVI 264

  Fly   348 DESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAEAIRRIHNKESMSYLF 399
            :||.:::::|||||||:.::..|.||:|||||.::||.|||||:.||:|.||
pombe   265 NESALEKVIVTNTIPHDDKRSLCSKIETIDISGVLAECIRRIHHGESVSVLF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2246NP_001189321.1 PrsA 25..400 CDD:223538 155/377 (41%)
Pribosyltran_N 29..144 CDD:290508 56/115 (49%)
Pribosyl_synth 185..400 CDD:291252 73/216 (34%)
SPCC1620.06cNP_588464.1 PrsA 4..316 CDD:223538 153/373 (41%)
Pribosyltran_N 6..122 CDD:290508 56/115 (49%)
PRTases_typeI 169..316 CDD:294217 70/208 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60704
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.