DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2246 and Prps2

DIOPT Version :9

Sequence 1:NP_001189321.1 Gene:CG2246 / 43637 FlyBaseID:FBgn0039790 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_006256891.1 Gene:Prps2 / 24689 RGDID:3415 Length:321 Species:Rattus norvegicus


Alignment Length:381 Identity:157/381 - (41%)
Similarity:222/381 - (58%) Gaps:66/381 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DIVIINGNSHPDLANMVAERMGIKNGGCSVFHKSNRETIVEISDSVRGKDIYIIQTGTKDANNNI 92
            :||:.:|:||.||:..||:|:|::.|.......||:||.|||.:||||:|:||||:|..:.|:|:
  Rat     3 NIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNL 67

  Fly    93 MELLIMAYACKTSSARSIVGVIPYLPYSKQCKMRK----RGCIVSKLLAKMMCTSGLTHIITMDL 153
            ||||||..|||.:|:..:..|||..||::|.|..|    |..|.:||:|.|:..:|..|||||||
  Rat    68 MELLIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHIITMDL 132

  Fly   154 HQKEIQGFFDIPVDNLRASPFLLQYIQESIPDYRNSVIVARNPGVAKKANSYAERLRLGLAVIHG 218
            |..:||||||||||||.|.|.:||:|:|:|.::||.:||:.:.|.||:..|.|:||.:..|:||.
  Rat   133 HASQIQGFFDIPVDNLYAEPAVLQWIRENITEWRNCIIVSPDAGGAKRVTSIADRLNVEFALIHK 197

  Fly   219 EQKETDADEVDGRYSPPPTSAYSNLLGNSVEMCLPATPRNSTPQHAPTSSARQRTTSVSVGVPEH 283
            |:|:  |:|||                                                      
  Rat   198 ERKK--ANEVD------------------------------------------------------ 206

  Fly   284 IVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKENGACKIYVLATHGLLSSDAPRQLD 348
                  .:.:||||..|:||:|||:.|.......||:.|...||.|:|.:.|||:.|..|..:::
  Rat   207 ------RMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRIN 265

  Fly   349 ESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAEAIRRIHNKESMSYLFRNVTL 404
            .:..:.:|||||||.|.:...|.||:.||||:::||||||.||.||:||||.:|.|
  Rat   266 NAAFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2246NP_001189321.1 PrsA 25..400 CDD:223538 154/375 (41%)
Pribosyltran_N 29..144 CDD:290508 55/118 (47%)
Pribosyl_synth 185..400 CDD:291252 71/214 (33%)
Prps2XP_006256891.1 PrsA 1..316 CDD:223538 153/374 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60704
OrthoDB 1 1.010 - - D1043963at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.