DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9717 and SLC26A9

DIOPT Version :9

Sequence 1:NP_651812.1 Gene:CG9717 / 43636 FlyBaseID:FBgn0039789 Length:638 Species:Drosophila melanogaster
Sequence 2:NP_599152.2 Gene:SLC26A9 / 115019 HGNCID:14469 Length:887 Species:Homo sapiens


Alignment Length:564 Identity:134/564 - (23%)
Similarity:240/564 - (42%) Gaps:113/564 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NIFR------KKTLYKRFPILVWLPQYK-KDYIFGDIVAGISVALTVIPQALAYAGIAGLDLQYG 119
            |.||      |..::...|:|.|||:|| ||||..|::.|:|.....:||.:|:|.:|.|....|
Human    39 NAFRCSSAKIKAVVFGLLPVLSWLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNG 103

  Fly   120 LYACFLGCFIYIFIGSSKDVPIGPTAISALL------------SFQIAGGS-------------- 158
            ||:.|.....|.|:|....:..|..|:.::|            .||:...:              
Human   104 LYSSFFPLLTYFFLGGVHQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNESYVDTAAMEAE 168

  Fly   159 -WQIATLLTFLTGLIEILMGVFRLGFLIDFVSGPVGAGFTSAVSLIIFSSQMKDFLGIK----TS 218
             ..::..|..||.:|::.:|..:.||:..::|.....||.:|..|.|..|.:|...|:.    |.
Human   169 RLHVSATLACLTAIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYTG 233

  Fly   219 GNTFLQVWISIVNDIHNISWPDFILGIVCITLLLSLRALASCTLGPKEGKTTAQKLLTGIFWTIG 283
            ..:.:..:|.|..::.:.:....|..::....|:.::.|.:             :.:..|.:.|.
Human   234 PGSIVFTFIDICKNLPHTNIASLIFALISGAFLVLVKELNA-------------RYMHKIRFPIP 285

  Fly   284 TARNALLVCGTAGLGYWLFVNG-----KENLVKTVGFVPKGLPSFQPPPFHMDAVVNETTGEVLQ 343
            | ...::|..||       ::|     |:..::.||.:.:|.|:...|      ||::       
Human   286 T-EMIVVVVATA-------ISGGCKMPKKYHMQIVGEIQRGFPTPVSP------VVSQ------- 329

  Fly   344 EAQSFW-DMVSTLGSGLIVVPLIALLETMAVVQAFADGKPTDATQELIASGVCNVANSFVQGLRS 407
                 | ||:.|..|..||..:|.|  .|....|...|...|:.||:||.|..|...||.:....
Human   330 -----WKDMIGTAFSLAIVSYVINL--AMGRTLANKHGYDVDSNQEMIALGCSNFFGSFFKIHVI 387

  Fly   408 NGGIARGAILNASGVRTQLSNLYTSVIVIIALLYLTPCFYYIPKAALASIIIAAVIFMVQYRVIK 472
            ...::....::.:|.::|:::|..|::|:|.:|.|....|.:||:.|.::|...:...:: ::..
Human   388 CCALSVTLAVDGAGGKSQVASLCVSLVVMITMLVLGIYLYPLPKSVLGALIAVNLKNSLK-QLTD 451

  Fly   473 P--MWHSKKTDLIPGLGAFFACLVLPLQLGILVGIGINVVFILYQA-----------------AR 518
            |  :|...|.|....:.:|.:...|.|..|:.||:..:|:.:::|.                 ..
Human   452 PYYLWRKSKLDCCIWVVSFLSSFFLSLPYGVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVN 516

  Fly   519 PKL--RIETLATTTGLKYLMLTPDRCLIFPSME-FVRKVINKQG 559
            ||.  |.:.:   .|:|  ::|....|.|.:.| |.:|||.|.|
Human   517 PKTYNRAQDI---QGIK--IITYCSPLYFANSEIFRQKVIAKTG 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9717NP_651812.1 sulP 74..607 CDD:273284 130/546 (24%)
STAS_SulP_like_sulfate_transporter 534..612 CDD:132913 10/27 (37%)
SLC26A9NP_599152.2 Sulfate_transp 74..468 CDD:279284 96/435 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 602..650
STAS_SulP_like_sulfate_transporter <662..730 CDD:132913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X49
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.