DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt6R and Shpk

DIOPT Version :10

Sequence 1:NP_651811.1 Gene:Rpt6R / 43635 FlyBaseID:FBgn0039788 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001028854.1 Gene:Shpk / 287479 RGDID:1308004 Length:472 Species:Rattus norvegicus


Alignment Length:46 Identity:17/46 - (36%)
Similarity:19/46 - (41%) Gaps:5/46 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LGITQPKGVLLYGPPG--TGKTLL---ARAVAHHTECTFIRVSGSE 212
            ||.|..|..||...||  :|..:|   |||....||.......|.|
  Rat    12 LGTTSVKAALLEAAPGHPSGFVVLASCARAAGAETESAAAGPQGRE 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt6RNP_651811.1 PRK03992 21..395 CDD:179699 17/46 (37%)
ShpkNP_001028854.1 ASKHA_NBD_FGGY_SHK 6..466 CDD:466796 17/46 (37%)

Return to query results.
Submit another query.