DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and emb2004

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_563871.1 Gene:emb2004 / 837591 AraportID:AT1G10510 Length:605 Species:Arabidopsis thaliana


Alignment Length:273 Identity:62/273 - (22%)
Similarity:102/273 - (37%) Gaps:68/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 FVQGKVRGKKWVP--PPRDARDIEAEEQ---------------IAIDMGEEYEHALNDATQE--- 216
            ||..||.||...|  |...|.:..:..|               .|..:..|.:..||:..:|   
plant   107 FVLWKVVGKFMSPKSPKTSAGENNSSTQGVKWSIGAGTNLLQGFAAKVDREAKQRLNEFAKELRS 171

  Fly   217 -EIID-------------LAAILGFHSMMNQDQYHASLLNKGQPVGL-GWDGITKSTQQKLFPMD 266
             ..:|             ||..||::..:.:..:.|   |.....|: .:||:.:|...      
plant   172 FRSVDMSGCNFGDEGLFFLAESLGYNQTVEEVSFSA---NGITAAGVKAFDGVLQSNIM------ 227

  Fly   267 PPNNTDVEESIKRVKDDDSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTA 331
                              .|:::|:.|   .|.||..:.|.|.|.:|..:|:|.|.:..:.|:.|
plant   228 ------------------LKILNLSGN---PIGDEGAKTLCATLMENSSIEILQLNSTDIGDEGA 271

  Fly   332 LLLAAAIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEITDL 396
            ..:|..::::.|||::.:..|.|.......|..|||:.:||.....:......||..   .:...
plant   272 KEIAELLKRNSTLRIIELNNNMIDYSGFTSLAGALLENNTIRNLHLNGNYGGALGAN---ALAKG 333

  Fly   397 VEKNSSLLRLGLH 409
            :|.|.||..|.||
plant   334 LEGNKSLRELHLH 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 20/94 (21%)
LRR_RI <285..421 CDD:238064 36/125 (29%)
emb2004NP_563871.1 LRR_RI 160..423 CDD:423007 50/220 (23%)
leucine-rich repeat 173..193 CDD:275380 3/19 (16%)
leucine-rich repeat 194..221 CDD:275380 6/29 (21%)
leucine-rich repeat 228..249 CDD:275380 7/23 (30%)
leucine-rich repeat 250..279 CDD:275380 8/28 (29%)
leucine-rich repeat 284..311 CDD:275380 8/26 (31%)
leucine-rich repeat 312..339 CDD:275380 5/29 (17%)
LRR_RI 315..577 CDD:423007 9/35 (26%)
leucine-rich repeat 340..368 CDD:275380 4/7 (57%)
leucine-rich repeat 369..396 CDD:275380
leucine-rich repeat 425..448 CDD:275380
leucine-rich repeat 453..480 CDD:275380
leucine-rich repeat 509..537 CDD:275381
leucine-rich repeat 538..561 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.