DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and LMOD3

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001291347.1 Gene:LMOD3 / 56203 HGNCID:6649 Length:560 Species:Homo sapiens


Alignment Length:507 Identity:122/507 - (24%)
Similarity:207/507 - (40%) Gaps:135/507 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DDVDVESLLAQLSPEEITILAKEVD---PDDNFLPPDQRNSYECTKEATGPLNRKQLIEHI---- 156
            ::::.:.:||.||.||:..|..|::   ||.: ||.......:..|..||..|.|.|::::    
Human    16 EEINEDEILANLSAEELKELQSEMEVMAPDPS-LPVGMIQKDQTDKPPTGNFNHKSLVDYMYWEK 79

  Fly   157 -NKQAIETPDQP---------------EFE-------PFVQGKV-----------RGKKWVPPPR 187
             :::.:|....|               |.|       .:::.|:           :|...: ...
Human    80 ASRRMLEEERVPVTFVKSEEKTQEEHEEIEKRNKNMAQYLKEKLNNEIVANKRESKGSSNI-QET 143

  Fly   188 DARDIEAEEQIAIDMGEEYEHALNDATQEE-----------------IIDLAAILGFHSMMNQDQ 235
            |..|.|.|:....|.||:......:..:||                 :.|.|    |....::.:
Human   144 DEEDEEEEDDDDDDEGEDDGEESEETNREEEGKAKEQIRNCENNCQQVTDKA----FKEQRDRPE 204

  Fly   236 YHASLLNKGQPVGLGWDGITKSTQQKLFPMDPP-----------------NNTDVEESIKRVKDD 283
                              ..:.:::|:..:||.                 |.||::.|::||:.:
Human   205 ------------------AQEQSEKKISKLDPKKLALDTSFLKVSTRPSGNQTDLDGSLRRVRKN 251

  Fly   284 DSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAAAIEKSKTLRVLN 348
            |..:.:||||||:||..|.|.....|:.:|:|::..||.|||..:..|..||..:.:::::..||
Human   252 DPDMKELNLNNIENIPKEMLLDFVNAMKKNKHIKTFSLANVGADENVAFALANMLRENRSITTLN 316

  Fly   349 VETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEITDLVEKNSSLLRLGLHLEFN 413
            :|:|||:...||.:::.|....|:.|.|..|||. :||:..||||..|::.|::||::|.|.|..
Human   317 IESNFITGKGIVAIMRCLQFNETLTELRFHNQRH-MLGHHAEMEIARLLKANNTLLKMGYHFELP 380

  Fly   414 DARHRVAAHLQRNIDR-------IFRVQKLKPNLPKLIL---------PGNMEIERDLVAYNRSA 462
            ..|..|...|.||.|:       ..:.|:||.. .|||.         ||..|:         ..
Human   381 GPRMVVTNLLTRNQDKQRQKRQEEQKQQQLKEQ-KKLIAMLENGLGLPPGMWEL---------LG 435

  Fly   463 TPSPS---------PSPQPPVDYEVEEDPDNMVIRGGGDAFDPDVDPDNMVV 505
            .|.|.         |.|:||....|.....:.:::....|.....|||:..|
Human   436 GPKPDSRMQEFFQPPPPRPPNPQNVPFSQRSEMMKKPSQAPKYRTDPDSFRV 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 36/191 (19%)
LRR_RI <285..421 CDD:238064 51/135 (38%)
LMOD3NP_001291347.1 Interaction with tropomyosin alpha. /evidence=ECO:0000269|PubMed:25250574 1..49 10/33 (30%)
Tropomodulin 16..>96 CDD:308723 20/80 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..68 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..217 14/112 (13%)
LRR_RI <253..374 CDD:330982 46/121 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..480 8/42 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 494..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1025132at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10901
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.