Sequence 1: | NP_001247372.1 | Gene: | tmod / 43633 | FlyBaseID: | FBgn0082582 | Length: | 567 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001373409.1 | Gene: | lrrc34 / 556175 | ZFINID: | ZDB-GENE-091118-73 | Length: | 410 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 45/197 - (22%) |
---|---|---|---|
Similarity: | 77/197 - (39%) | Gaps: | 52/197 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 212 DATQEEIIDLAAILGFHSMMNQDQYHASLL-----NKGQPVGLGWDGITKSTQQKLFPMDPPNNT 271
Fly 272 DVEESIKRVKDDDSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAA 336
Fly 337 AIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEITDLVEKNS 401
Fly 402 SL 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tmod | NP_001247372.1 | Tropomodulin | 91..233 | CDD:281268 | 4/20 (20%) |
LRR_RI | <285..421 | CDD:238064 | 25/119 (21%) | ||
lrrc34 | NP_001373409.1 | RNA1 | <21..>138 | CDD:227563 | 36/156 (23%) |
leucine-rich repeat | 67..94 | CDD:275381 | 9/26 (35%) | ||
LRR_RI | <95..332 | CDD:423007 | 13/60 (22%) | ||
leucine-rich repeat | 95..122 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 123..150 | CDD:275380 | 5/29 (17%) | ||
leucine-rich repeat | 151..178 | CDD:275380 | 1/1 (100%) | ||
leucine-rich repeat | 179..202 | CDD:275380 | |||
leucine-rich repeat | 210..237 | CDD:275380 | |||
leucine-rich repeat | 238..265 | CDD:275380 | |||
leucine-rich repeat | 266..292 | CDD:275380 | |||
leucine-rich repeat | 323..344 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |