DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and lrrc34

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001373409.1 Gene:lrrc34 / 556175 ZFINID:ZDB-GENE-091118-73 Length:410 Species:Danio rerio


Alignment Length:197 Identity:45/197 - (22%)
Similarity:77/197 - (39%) Gaps:52/197 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 DATQEEIIDLAAILGFHSMMNQDQYHASLL-----NKGQPVGLGWDGITKSTQQKLFPMDPPNNT 271
            |...|..:.:.|.|       |...|||:|     ||.....|           ||...|.|.  
Zfish     2 DDLMERYLSVCAEL-------QQPTHASVLEVLGNNKSSDCCL-----------KLAGNDQPG-- 46

  Fly   272 DVEESIKRVKDDDSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAA 336
                  .|:.|||..::...|..                  |..::.|.|....:|||.|:.:|.
Zfish    47 ------ARLTDDDMLVLTKTLEG------------------NSAIKGLDLRYNCITDKGAVHIAH 87

  Fly   337 AIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEITDLVEKNS 401
            .|:.||:|:.|::..|.|.......:.::|.|..|::..|.:..:   :||:..|::..:::.|:
Zfish    88 LIQDSKSLQSLDLMCNDIEADGAEVIAKSLHKNITLKTLRMTGNK---IGNQGAMQLATMLQINA 149

  Fly   402 SL 403
            :|
Zfish   150 TL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 4/20 (20%)
LRR_RI <285..421 CDD:238064 25/119 (21%)
lrrc34NP_001373409.1 RNA1 <21..>138 CDD:227563 36/156 (23%)
leucine-rich repeat 67..94 CDD:275381 9/26 (35%)
LRR_RI <95..332 CDD:423007 13/60 (22%)
leucine-rich repeat 95..122 CDD:275380 6/26 (23%)
leucine-rich repeat 123..150 CDD:275380 5/29 (17%)
leucine-rich repeat 151..178 CDD:275380 1/1 (100%)
leucine-rich repeat 179..202 CDD:275380
leucine-rich repeat 210..237 CDD:275380
leucine-rich repeat 238..265 CDD:275380
leucine-rich repeat 266..292 CDD:275380
leucine-rich repeat 323..344 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.