DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and tmod4

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001016737.1 Gene:tmod4 / 549491 XenbaseID:XB-GENE-5884940 Length:346 Species:Xenopus tropicalis


Alignment Length:353 Identity:125/353 - (35%)
Similarity:210/353 - (59%) Gaps:19/353 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YGKDLSEYDDVDVESLLAQLSPEEITIL---AKEVDPDDNFLPPDQRNSYECTKEATGPLNRKQL 152
            |.|:|.:|.|:|.:.|:..:||||:..|   .:|:||::..||...|...:.||..||||:|..|
 Frog     3 YQKELEKYRDIDEDELMKAMSPEELAQLDFELQEMDPENVLLPAGMRQKDQTTKNPTGPLDRDAL 67

  Fly   153 IEHINKQAIETPDQPEFEPFVQGKVRGKKWVPPPRDARDIEAEEQIAIDMGEEYEHALNDATQEE 217
            :.|:.|:|||..::.:..||. |:.:||.:| |.:..|:|..||||.::  .|.|.||.:||..|
 Frog    68 LHHLEKEAIEYKERDDLVPFT-GEKKGKVFV-PKQAKREIPKEEQITLE--PELEEALANATDAE 128

  Fly   218 IIDLAAILGFHSMMNQDQYHAS-----LLNKGQPVGLGWDGITKSTQQKLFPMDPPNNTDVEESI 277
            :.|:|||||.:::|:..||:.:     :.||.     |.:.:.|....|..|.:|||.|:|||::
 Frog   129 MCDIAAILGMYTLMSNKQYYDAITTGIITNKE-----GINSVVKPDSYKPVPDEPPNPTNVEETL 188

  Fly   278 KRVKDDDSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAAAIEKSK 342
            |:::.:.|.|.::||||||:|....|:::..|:..|.|:::|||......|..|..:|..::::|
 Frog   189 KKIQSNASDLEEVNLNNIKDIPVPTLKEICQAMKSNSHVKILSLVATRSNDPVAYAVAEMLKENK 253

  Fly   343 TLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEITDLVEKNSSLLRLG 407
            ||:.||:|:|||:...::.::||:...:.:.|.:..|||.. ||:.:|||:..::|...|::|.|
 Frog   254 TLQSLNIESNFITSAGMLAILQAMRSNNMLSELKVDNQRQN-LGDTVEMEMASMLENCPSIIRFG 317

  Fly   408 LHLEFNDARHRVAAHLQRNIDRIFRVQK 435
            .|......|.|.|..:.:|:: :.|.||
 Frog   318 YHFTRQGPRARAATAITKNLE-LRRKQK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 58/144 (40%)
LRR_RI <285..421 CDD:238064 46/135 (34%)
tmod4NP_001016737.1 Tropomodulin 3..144 CDD:397382 58/144 (40%)
LRR_RI <185..>281 CDD:423007 33/95 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I5059
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3440
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1025132at2759
OrthoFinder 1 1.000 - - FOG0001180
OrthoInspector 1 1.000 - - otm47659
Panther 1 1.100 - - O PTHR10901
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X804
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.