DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and bcas2

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_988924.1 Gene:bcas2 / 394520 XenbaseID:XB-GENE-959514 Length:223 Species:Xenopus tropicalis


Alignment Length:236 Identity:49/236 - (20%)
Similarity:87/236 - (36%) Gaps:69/236 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YDDVDVESLLAQLSPEEITILAKEVDPDDNFL----PPD--------QRNSYECTKEATGPLNRK 150
            ||...|....|.|..||    .:...|..|:|    .||        .||.:|       .|:.:
 Frog    23 YDAQGVREAAAALVEEE----TRRYRPTKNYLSYLPTPDYSAFETEIMRNEFE-------RLSSR 76

  Fly   151 QLIEHINKQAIETPDQPEFEPFVQGKVRGKKWVPPPRDARDIEAEEQIAIDMGEEYEHALNDATQ 215
            |.:|.::.:..|.|                  .|......||.|.::...:...:.||   .|.:
 Frog    77 QPLELLSMKRYELP------------------APLSGQRNDITAWQECVNNSMAQLEH---QAVR 120

  Fly   216 EEIIDLAAILGFHS--MMNQDQYH---------ASLLNKGQPVGLGWDGITKSTQ----QKLFPM 265
            .|.::|.:..|.::  :.|::..|         ..|..|.|  .|.|.  .|::|    .:|..|
 Frog   121 IENLELMSQHGCNAWKVYNENLLHMIDCAQKDLQKLRKKIQ--DLNWQ--RKNSQLTAGARLREM 181

  Fly   266 DP------PNNTDVEESIKRVKDDDSKLIDLNLNNIKNISD 300
            :.      ..|.::|.:|.:::::..:|.:.:..|.:||.|
 Frog   182 ESTWVSLVSKNYEIERAIVQMENEVYQLKERSGENKENIED 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 30/148 (20%)
LRR_RI <285..421 CDD:238064 5/16 (31%)
bcas2NP_988924.1 BCAS2 11..212 CDD:368566 45/224 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165175683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.