DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and Tcte1

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001101676.1 Gene:Tcte1 / 316242 RGDID:1305744 Length:498 Species:Rattus norvegicus


Alignment Length:339 Identity:72/339 - (21%)
Similarity:128/339 - (37%) Gaps:86/339 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 DNFLPPDQRNSYECTKEATGPLNRKQLIEHINKQAIETPDQPEFEPFVQGKVRGKKWVPPPRDAR 190
            |.||||        .:..|.|...:|.......:..| |::..::  :|..|.|.|::       
  Rat   192 DQFLPP--------VRMPTPPQGEEQSDSGSEGEGNE-PEKNHYQ--LQALVGGLKYL------- 238

  Fly   191 DIEAEEQIAI-----DMGEEYEHALNDATQEEIIDLAA-ILGFHSMMNQDQYHASLLNKGQPVGL 249
                 |::.:     |.|..:|..|...|..:...||| |...|::.                  
  Rat   239 -----EELDLVYGVKDCGMNFEWNLFLFTYRDCHSLAATIKACHTLK------------------ 280

  Fly   250 GWDGITKSTQQKLFP----------MDPPNNTDVEESIKRVKDDD----SKLIDLNLNNIKNISD 300
                |.:.|:.|:..          :|.|...:::.|...:.|..    :||:..:...:.|:::
  Rat   281 ----IFRLTRSKVDDDKARILIRSLLDHPALEELDLSHNLIGDRGARAAAKLLSHSRLRVLNLAN 341

  Fly   301 EKL-----EQLFAALPQNEHLEVLSLTNVGLTDKTALLLAAAIEKSKTLRVLNVETNFISPPVIV 360
            .:|     :.|..||..|.:|..|:|....:.|:....:|.|:|.:|.|.|||:..|.:|.|...
  Rat   342 NQLRASGAQSLAHALAHNTNLVSLNLRLNCIEDEGGQAIAHALETNKCLTVLNLGGNELSEPTAT 406

  Fly   361 KLVQAL----------LKCHTIEEFRASNQRSAVLGNK----IEMEITDLVEKNSSLLRLGLHLE 411
            .|.|.|          |.|:.|.:.........:..||    .::.::|:.:::..|:...||..
  Rat   407 LLSQVLPVNTTLISLNLSCNHIGQDGGKQLLEGMSDNKTILEFDLRLSDVAQESEYLIGQVLHNN 471

  Fly   412 FNDARHRVAA--HL 423
            ...||.|..:  ||
  Rat   472 REAARQRTLSPGHL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 25/112 (22%)
LRR_RI <285..421 CDD:238064 38/154 (25%)
Tcte1NP_001101676.1 LRR_RI 177..484 CDD:238064 70/336 (21%)
leucine-rich repeat 307..333 CDD:275380 4/25 (16%)
leucine-rich repeat 334..361 CDD:275380 6/26 (23%)
leucine-rich repeat 362..389 CDD:275380 7/26 (27%)
leucine-rich repeat 390..417 CDD:275380 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.