DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and TMOD4

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_037485.2 Gene:TMOD4 / 29765 HGNCID:11874 Length:345 Species:Homo sapiens


Alignment Length:349 Identity:120/349 - (34%)
Similarity:205/349 - (58%) Gaps:13/349 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YGKDLSEYDDVDVESLLAQLSPEEITIL---AKEVDPDDNFLPPDQRNSYECTKEATGPLNRKQL 152
            |.|:|.:|.|:|.:.:|..|||||:..|   .:|:||::..||...|...:..|..||||:|:.|
Human     4 YQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREAL 68

  Fly   153 IEHINKQAIETPDQPEFEPFVQGKVRGKKWVPPPRDARDIEAEEQIAIDMGEEYEHALNDATQEE 217
            ::::.:||:|..::.:..||. |:.:||.::.|   .|:|.|||||.::  .|.|.||..||..|
Human    69 LQYLEQQALEVKERDDLVPFT-GEKKGKPYIQP---KREIPAEEQITLE--PELEEALAHATDAE 127

  Fly   218 IIDLAAILGFHSMMNQDQYHASLLNKGQPVGL-GWDGITKSTQQKLFPMDPPNNTDVEESIKRVK 281
            :.|:||||..:::|:..||:.:|.: |:.... |...:.:..:.|..|.:|||.|::||.:|||:
Human   128 MCDIAAILDMYTLMSNKQYYDALCS-GEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVR 191

  Fly   282 DDDSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAAAIEKSKTLRV 346
            .:|.:|.::|||||::|....|.:|..|:..|.::...||......|..|..:|..:.::::|:.
Human   192 SNDKELEEVNLNNIQDIPIPMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLRENRSLQS 256

  Fly   347 LNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEITDLVEKNSSLLRLGLHLE 411
            ||:|:||||...::.:::|:.:..|:.|.|..|||... |:.:|||:..::|:..|::|.|.|..
Human   257 LNIESNFISSTGLMAVLKAVRENATLTELRVDNQRQWP-GDAVEMEMATVLEQCPSIVRFGYHFT 320

  Fly   412 FNDARHRVAAHLQRNIDRIFRVQK 435
            ....|.|.|..:.|| :.:.|.||
Human   321 QQGPRARAAQAMTRN-NELRRQQK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 55/144 (38%)
LRR_RI <285..421 CDD:238064 42/135 (31%)
TMOD4NP_037485.2 Tropomodulin 4..143 CDD:397382 55/144 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..63 6/20 (30%)
LRR_RI <184..>286 CDD:423007 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157771
Domainoid 1 1.000 134 1.000 Domainoid score I5012
eggNOG 1 0.900 - - E1_KOG3735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3507
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47963
OrthoDB 1 1.010 - - D1025132at2759
OrthoFinder 1 1.000 - - FOG0001180
OrthoInspector 1 1.000 - - otm40482
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10901
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2851
SonicParanoid 1 1.000 - - X804
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.