DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and Lmod2

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001094434.1 Gene:Lmod2 / 296935 RGDID:1592092 Length:549 Species:Rattus norvegicus


Alignment Length:498 Identity:129/498 - (25%)
Similarity:219/498 - (43%) Gaps:117/498 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YGKDLSEYDDVDVESLLAQLSPEEITILAKE---VDPDDNFLPPDQRNSYECTKEATGPLNRKQL 152
            |.:.||:|:.:|.:.|||.|:.||:..|.:|   ::||.| ||...|......|..||..:|:.|
  Rat     6 YRRGLSKYESIDEDELLASLTAEELKELERELEDIEPDRN-LPVGLRQKSLTEKTPTGNFSREAL 69

  Fly   153 IEHINKQA--------------IETPDQPEFEP---FVQGKVRGKKWVPPPRDARDIEAEEQIAI 200
            :.:..|::              :...|:.|.|.   |.:......:.|....:....|.||:   
  Rat    70 MAYWEKESQKLLEKERLGECGKLAEEDKEESEEELIFTESNSEVSEEVCTEEEEESTEEEEE--- 131

  Fly   201 DMGEEYEHALNDATQEEIIDLAA--ILG--FHSMMNQDQ-----YHASLLNKGQPVGL--GWDGI 254
               ||.|    |:.:||:.....  |.|  .|:.:|.|.     :.:.:.|    :.|  |..|.
  Rat   132 ---EEEE----DSEEEEVTTEVTKHINGTVSHNGVNPDNSKPKTFKSQIEN----INLTNGNSGG 185

  Fly   255 TKSTQQKLFPMDPPNN-TDVEESIKRVKDDDSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEV 318
            |:...:....:.|..| |.:|::::::|::|....::|||||:||:.:.|.:...||.:|..::.
  Rat   186 TQRNTESPAAIHPCGNPTVIEDALEKIKNNDPDTTEVNLNNIENITTQTLSRFAEALKENTVVKT 250

  Fly   319 LSLTNVGLTDKTALLLAAAIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSA 383
            .||.|....|..|:.:|..::.::.:..:|||:|||:...|:.:::||.....:.|.|..|||. 
  Rat   251 FSLANTHADDAAAIAIAEMLKVNEHITSVNVESNFITGKGILAIMRALQHNTVLTELRFHNQRH- 314

  Fly   384 VLGNKIEMEITDLVEKNSSLLRLGLHLEFNDARHRVAAHLQRNID--RIFRVQKLK--------- 437
            ::|:::||||..|:::|::|||||.|.|....|..:.:.|.||:|  |..|:|:.|         
  Rat   315 IMGSQVEMEIVKLLKENTTLLRLGYHFELPGPRMSMTSILTRNMDKQRQKRMQEQKQQEGHDGGA 379

  Fly   438 ---------------------------PNLPKLILPGNMEIERDLVAYNRSATPS----PSPSPQ 471
                                       |.:.|.:..|            ||..||    |.|.|.
  Rat   380 TLRTKVWQRGTPGSSPYASPRQSPWSSPKVSKKVHTG------------RSRPPSPVAPPPPPPP 432

  Fly   472 PPVDYEVEEDPDNMVIRGGGDAFDPDVDPDNMVVPGSRSVTPN 514
            ||:       |.:|:        .|...|....:||.:.:|.|
  Rat   433 PPL-------PPHML--------PPPPPPPAPPLPGKKLITRN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 42/165 (25%)
LRR_RI <285..421 CDD:238064 46/135 (34%)
Lmod2NP_001094434.1 Interaction with actin 1. /evidence=ECO:0000250|UniProtKB:Q6P5Q4 1..164 44/168 (26%)
Interaction with tropomyosin alpha. /evidence=ECO:0000250|UniProtKB:Q6P5Q4 1..47 16/41 (39%)
Tropomyosin-binding. /evidence=ECO:0000250 1..42 13/35 (37%)
Tropomodulin 6..>85 CDD:281268 25/79 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..166 19/84 (23%)
Interaction with actin 2. /evidence=ECO:0000250|UniProtKB:Q6P5Q4 165..499 85/328 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200 4/20 (20%)
LRR_RI <229..>338 CDD:238064 36/109 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..455 23/123 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 469..534
Interaction with actin 3. /evidence=ECO:0000250|UniProtKB:Q6P5Q4 523..542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I3491
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1025132at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10901
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.