DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and Nlrc3

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_006245896.3 Gene:Nlrc3 / 287070 RGDID:1304902 Length:1090 Species:Rattus norvegicus


Alignment Length:232 Identity:59/232 - (25%)
Similarity:98/232 - (42%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 MGEEYEHALNDATQEEIIDLAAILGFHSMMNQD---QYHASLLNKGQPVGLGWDGITKSTQQKLF 263
            :|.:...||.||.  :|......|...|.:.:|   .|.|..|...|.:.      |...|:.| 
  Rat   731 IGPQGAKALADAL--KINRTLTSLSLQSNVIKDDGVMYMAEALVSNQIIS------TLQLQKNL- 786

  Fly   264 PMDPPNNTDVEESIKRVKDDDSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTD 328
             :.|.....:.:::|:    :..|.:|..:: ..|.|.....|..||..|:.||.|.|.:..:::
  Rat   787 -IGPRGAQQMADALKK----NRSLRELMFSS-NTIGDRGAMALAEALKVNQGLENLDLQSNAISN 845

  Fly   329 KTALLLAAAIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEI 393
            ....:|..|:..::||..||:..|.|||.....|.|||.:..|::..   :..:.:|.::....|
  Rat   846 TGVAVLMRALCTNQTLSSLNLRENSISPEGAQALAQALCRNTTLKHL---DLTANLLHDQGAQAI 907

  Fly   394 TDLVEKNSSLLRLGLHLEFN----DARHRVAAHLQRN 426
            ...|.:|.||..  |||::|    .|...:...||.|
  Rat   908 ATAVGENCSLTH--LHLQWNFIQAGAARALGQALQLN 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 8/30 (27%)
LRR_RI <285..421 CDD:238064 38/139 (27%)
Nlrc3XP_006245896.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.