DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and Tcte1

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_038716.2 Gene:Tcte1 / 21645 MGIID:98640 Length:498 Species:Mus musculus


Alignment Length:479 Identity:95/479 - (19%)
Similarity:175/479 - (36%) Gaps:121/479 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TSVVTEHTEEVIPGETEKMVTET------IDEDGD----VVEETTEVTRKTVKRTMKITETSATT 79
            ||:.|..|.  .||:.:..|...      |.||.:    :|...||:   .::..:|..:.:...
Mouse    36 TSLKTSSTP--TPGQLKTKVPNVRRMRRIISEDAEWSLAIVPLLTEL---CIQHIVKNFQNNPIL 95

  Fly    80 KTTTLTTPAKLYGKDLSEYDDVDVESLLAQLSPE-EITILAKEVDPDDNFLPPDQRNSYEC---- 139
            |...|....|                :|:.|.|| .:|:.|..:| |:|:.       :.|    
Mouse    96 KQLPLEHQKK----------------VLSNLPPELPLTVTANLID-DENYW-------HRCCIKR 136

  Fly   140 -----TKEATGPLNR---KQLIEHINKQAIETPDQP----EFEPFVQGKVRG---KKWVPPPRDA 189
                 .....|...|   ::.:|::.|..|.....|    :..|..:..||.   .:::||.|..
Mouse   137 WSVCHVSRHGGSWKRMFFERHLENLLKLFIPGTTDPNVILDLLPLCRNYVRRIHVDQFLPPVRMP 201

  Fly   190 RDIEAEEQIAIDMGEEYEHALNDATQEEIIDLAAILGFHSMMNQDQYHASLLNKGQPVGLGWD-- 252
            ..::.|||  .|.|.|.|   ....:::...|..::|  .:.:.::.......|...:...|:  
Mouse   202 TPLQGEEQ--SDSGSEGE---GSEPEKDHYQLQTLVG--GLKHLEELDLVYGVKDCGMNFEWNLF 259

  Fly   253 --------------------GITKSTQQKLFP----------MDPPNNTDVEESIKRVKDDD--- 284
                                .|.|.|:.|:..          :|.|...:::.|...:.|..   
Mouse   260 LFTYRDCYSLAATIKACHTLKIFKLTRSKVDDDKARILIRSLLDHPALEELDLSHNLIGDRGARA 324

  Fly   285 -SKLIDLNLNNIKNISDEKL-----EQLFAALPQNEHLEVLSLTNVGLTDKTALLLAAAIEKSKT 343
             :||:..:...:.|:::.:|     :.|..||..|.:|..|:|....:.|:....:|.|:|.:|.
Mouse   325 AAKLLSHSRLRVLNLANNQLQAPGAQSLAHALAHNTNLVFLNLRLNCIEDEGGQAIAHALETNKC 389

  Fly   344 LRVLNVETNFISPPVIVKLVQAL----------LKCHTIEEFRASNQRSAVLGNK----IEMEIT 394
            |.||::..|.:|.|....|.|.|          |.|:.|.:.........:..||    .::.::
Mouse   390 LSVLHLGGNKLSEPTATLLSQMLTVNTTLVSLNLSCNHIGQDGGKQLLEGISDNKTILEFDLRLS 454

  Fly   395 DLVEKNSSLLRLGLHLEFNDARHR 418
            |:.:::..|:...||.....||.|
Mouse   455 DVSQESEYLIGQVLHANREAARQR 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 31/161 (19%)
LRR_RI <285..421 CDD:238064 37/153 (24%)
Tcte1NP_038716.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..52 6/17 (35%)
LRR_RI 177..487 CDD:238064 62/309 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223 7/27 (26%)
leucine-rich repeat 238..278 CDD:275381 2/39 (5%)
LRR 1 276..299 4/22 (18%)
LRR 2 306..327 2/20 (10%)
leucine-rich repeat 307..333 CDD:275380 4/25 (16%)
LRR 3 333..353 2/19 (11%)
leucine-rich repeat 334..361 CDD:275380 6/26 (23%)
LRR 4 361..382 4/20 (20%)
leucine-rich repeat 362..389 CDD:275380 7/26 (27%)
LRR 5 389..409 6/19 (32%)
leucine-rich repeat 390..417 CDD:275380 9/26 (35%)
LRR 6 417..438 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.