DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and TCTE1

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_872345.2 Gene:TCTE1 / 202500 HGNCID:11693 Length:501 Species:Homo sapiens


Alignment Length:502 Identity:103/502 - (20%)
Similarity:180/502 - (35%) Gaps:120/502 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGSAEETKPEPDAQSKTSVVTEHTEEVIPGETEKMVTETIDEDGD----VVEETTEVTRKTVKRT 69
            ||....|.|:....|.|.|..: :....|....:.:...|.||.:    :|...||:..:.:.|.
Human    27 GGHTSSTSPQLSKPSITPVPAK-SRNPHPRANIRRMRRIIAEDPEWSLAIVPLLTELCIQHIIRN 90

  Fly    70 MKITETSATTKTTTLTTPAKLYGKDLSEYDDVDVESLLAQLSPE-EITILAKEVDPDDNFLPPDQ 133
            .:        |...|.       :.|.|:.    :.:|..|||: .:.:.|..:|.::.:|....
Human    91 FQ--------KNPILK-------QMLPEHQ----QKVLNHLSPDLPLAVTANLIDSENYWLRCCM 136

  Fly   134 RNSYECTKEATGPLNRKQL----IEHINKQAIETPDQP----EFEPFVQGKVRG---KKWVPP-- 185
            .....|.....|...::..    :|::.|..|.....|    :..|..:..||.   .:::||  
Human   137 HRWPVCHVAHHGGSWKRMFFERHLENLLKHFIPGTTDPAVILDLLPLCRNYVRRVHVDQFLPPVQ 201

  Fly   186 ------PRDARDIEAE-----------------------EQIAI-----DMGEEYEHALNDATQE 216
                  |.|..|..:|                       |::.:     |.|..:|..|...|..
Human   202 LPAQLRPGDQSDSGSEGEMEEPTVDHYQLGDLVAGLSHLEELDLVYDVKDCGMNFEWNLFLFTYR 266

  Fly   217 EIIDL-AAILGFH---------SMMNQDQYH---ASLLNKGQPV------------GLGWDGITK 256
            :.:.| |||...|         |.::.|:..   .|||:  .||            ..|..|..|
Human   267 DCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSLLD--HPVLEELDLSQNLIGDRGARGAAK 329

  Fly   257 -STQQKLFPMDPPNN---TDVEESIKRVKDDDSKLIDLNLNNIKNISDEKLEQLFAALPQNEHLE 317
             .:..:|..::..||   ....:|:......::.||.||| .:..|.||..:.|..||..|:.|.
Human   330 LLSHSRLRVLNLANNQVRAPGAQSLAHALAHNTNLISLNL-RLNCIEDEGGQALAHALQTNKCLT 393

  Fly   318 VLSLTNVGLTDKTALLLAAAIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRS 382
            .|.|....|::.||.||:..:..:.||..:|:..|.|......:|::.:....|:.||       
Human   394 TLHLGGNELSEPTATLLSQVLAINTTLTSINLSCNHIGLDGGKQLLEGMSDNKTLLEF------- 451

  Fly   383 AVLGNKIEMEITDLVEKNSSLLRLGLHLEFNDARHRV--AAHLQRNI 427
                   ::.::|:.:::..|:...|:.....||.|.  .:|....|
Human   452 -------DLRLSDVAQESEYLIGQALYANREAARQRALNPSHFMSTI 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 36/199 (18%)
LRR_RI <285..421 CDD:238064 35/137 (26%)
TCTE1NP_872345.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 8/29 (28%)
LRR_RI 179..489 CDD:238064 70/326 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..222 4/19 (21%)
LRR 1 308..321 1/12 (8%)
leucine-rich repeat 309..335 CDD:275380 3/25 (12%)
LRR 2 335..355 4/19 (21%)
leucine-rich repeat 336..363 CDD:275380 4/26 (15%)
LRR 3 363..383 8/20 (40%)
leucine-rich repeat 364..391 CDD:275380 12/27 (44%)
LRR 4 391..411 7/19 (37%)
leucine-rich repeat 392..419 CDD:275380 8/26 (31%)
LRR 5 419..439 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.