DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and LRRC74A

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_011534781.1 Gene:LRRC74A / 145497 HGNCID:23346 Length:529 Species:Homo sapiens


Alignment Length:172 Identity:45/172 - (26%)
Similarity:76/172 - (44%) Gaps:25/172 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 ESIKRVKDDDSKLI-----DLNLNNIKNISDEKLEQLFAALP-----QNEHLEVLSLTNVGLTDK 329
            |||.  |.||.|..     :|.|...|         |...:|     :|.....::|.:.||..:
Human    83 ESIH--KQDDEKFFTTGQKELYLEACK---------LMGVVPVSYFIRNMEESYVNLNHHGLGPR 136

  Fly   330 TALLLAAAIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEIT 394
            ....:|.|:..:..:..|.:|.|.|....::.||:.|.:.:.::|...||....:.|.:|   |:
Human   137 GTKAIAIALVSNMAVTKLELEDNCIMEEGVLSLVEMLQENYYLQEMNISNNHLGLEGARI---IS 198

  Fly   395 DLVEKNSSLLRLGLHLEFNDARHRVAAHLQRNIDRIFRVQKL 436
            |..|:|||.: ..|.|..||.:...||.|.:.:...::::||
Human   199 DFFERNSSSI-WSLELSGNDFKEDSAALLCQALSTNYQIKKL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268
LRR_RI <285..421 CDD:238064 34/145 (23%)
LRRC74AXP_011534781.1 LRR_RI 128..384 CDD:330982 32/116 (28%)
leucine-rich repeat 152..174 CDD:275380 6/21 (29%)
leucine-rich repeat 179..207 CDD:275380 10/30 (33%)
leucine-rich repeat 208..235 CDD:275380 7/27 (26%)
leucine-rich repeat 236..259 CDD:275380 2/4 (50%)
leucine-rich repeat 264..291 CDD:275380
leucine-rich repeat 292..319 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.