DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and LOC100493539

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_012810999.1 Gene:LOC100493539 / 100493539 -ID:- Length:362 Species:Xenopus tropicalis


Alignment Length:160 Identity:31/160 - (19%)
Similarity:62/160 - (38%) Gaps:36/160 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 LNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAAAIEKSKTLRVLNVETNFI 354
            ||:|.||   ||.......||....|.:.::.|::...:....:....:.| |.|:.|||..|  
 Frog    78 LNINTIK---DEHASLHKNALEMAVHFQPINNTSISKHENVTQMDVEPMIK-KQLQELNVMEN-- 136

  Fly   355 SPPVIVKLVQALLKCHTIEEFRASNQRSA--VLGN--------KIEMEITDLVEKNSSLLRL--- 406
                    |..|.:.|.:|    :|.:|.  ::.:        |::.::..:..:|:...:|   
 Frog   137 --------VNLLKRLHALE----TNMKSMKNIVSSHGEDLKTVKVQQQVEGIKHENALQRQLNNI 189

  Fly   407 -----GLHLEFNDARHRVAAHLQRNIDRIF 431
                 |.|:...:......:.:.:..|.:|
 Frog   190 SRDLNGFHIRLEEGLDLAFSQISQLRDDVF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268
LRR_RI <285..421 CDD:238064 29/148 (20%)
LOC100493539XP_012810999.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.