DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tmod and tmod1

DIOPT Version :9

Sequence 1:NP_001247372.1 Gene:tmod / 43633 FlyBaseID:FBgn0082582 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_002936736.2 Gene:tmod1 / 100486576 XenbaseID:XB-GENE-954354 Length:359 Species:Xenopus tropicalis


Alignment Length:339 Identity:127/339 - (37%)
Similarity:197/339 - (58%) Gaps:9/339 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KDLSEYDDVDVESLLAQLSPEEITIL---AKEVDPDDNFLPPDQRNSYECTKEATGPLNRKQLIE 154
            |||.:|.|:|.:.:|.:|:.||:|.|   .:|:|||:..||...|...:..|.||||..|..|::
 Frog     5 KDLEKYRDLDEDEILNKLTDEELTALEGELEELDPDNELLPAGLRQRDQTKKMATGPFQRDALLD 69

  Fly   155 HINKQAIETPDQPEFEPFVQGKVRGKKWVPPPRDARDIEAEEQIAIDMGEEYEHALNDATQEEII 219
            |:.|||.|..|:.:..|:. |:.|||.|: |.:...|...|.   :.:..|.|.||.:|:..|:.
 Frog    70 HLEKQAKEIKDKEDLVPYT-GEKRGKPWI-PKKTVVDPVLEN---VTLEPELEEALANASDAELC 129

  Fly   220 DLAAILGFHSMMNQDQYHASLLNKGQPVGLGWDGITKSTQQKLFPMDPPNNTDVEESIKRVKDDD 284
            |:|||||.|::|:..||:.:|.:.......|.:.:.|.||.|..|.:.||:||||::::|:|::|
 Frog   130 DIAAILGMHTLMSNQQYYEALASSNIVNKEGLNSVIKPTQYKPVPDEEPNSTDVEDTLERIKNND 194

  Fly   285 SKLIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAAAIEKSKTLRVLNV 349
            ..|.|:|||||:||....|:....|:..|.|::.||:......|..|..||..::.:.||:.|||
 Frog   195 PDLEDVNLNNIRNIPILTLKDYAEAMKTNTHVQKLSIVGTRSNDPVAYALADMLKVNSTLKSLNV 259

  Fly   350 ETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLGNKIEMEITDLVEKNSSLLRLGLHLEFND 414
            |:||||...|:.::::|....::.|.:..|| |..||||.||:|..::||||:||:.|.|.....
 Frog   260 ESNFISGSGILSIIESLQYNTSLVELKIDNQ-SQPLGNKAEMDIASMLEKNSTLLKFGYHFTQQG 323

  Fly   415 ARHRVAAHLQRNID 428
            .|.|.:..:..|.|
 Frog   324 PRLRASNAMMNNND 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tmodNP_001247372.1 Tropomodulin 91..233 CDD:281268 55/142 (39%)
LRR_RI <285..421 CDD:238064 52/135 (39%)
tmod1XP_002936736.2 Tropomodulin 4..143 CDD:367418 55/142 (39%)
LRR_RI <213..>314 CDD:393385 38/101 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20701
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1025132at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2851
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.