DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tmod and cav3.2

DIOPT Version :9

Sequence 1:	NP_001247372.1	Gene:	tmod / 43633	FlyBaseID:	FBgn0082582	Length:	567	Species:	Drosophila melanogaster
Sequence 2:	NP_001096351.1	Gene:	cav3.2 / 100124941	XenbaseID:	XB-GENE-5815090	Length:	153	Species:	Xenopus tropicalis

Alignment Length:	52	Identity:	16/52 - (30%)
Similarity:	26/52 - (50%)	Gaps:	3/52 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    87 PAKLYGKDLSEYDDVDVESLLAQLSPEEITILAKEVDPDDNFLPPDQRNSYE 138
            |||   :|.|..:.:..|..|.|..|::|.....:||.:|....||..:|::
Frog     9 PAK---QDKSNTEALTKEIDLVQRDPKKINQEVVQVDFEDVIAEPDGTHSFD 57

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tmod	NP_001247372.1	Tropomodulin	91..233	CDD:281268	13/48 (27%)
tmod	NP_001247372.1	LRR_RI	<285..421	CDD:238064
cav3.2	NP_001096351.1	Caveolin	20..150	CDD:366489	11/38 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165175685
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930