powered by:
Protein Alignment jdp and MDJ2
DIOPT Version :9
Sequence 1: | NP_651807.1 |
Gene: | jdp / 43630 |
FlyBaseID: | FBgn0027654 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014071.1 |
Gene: | MDJ2 / 855388 |
SGDID: | S000005272 |
Length: | 146 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 69 |
Identity: | 18/69 - (26%) |
Similarity: | 33/69 - (47%) |
Gaps: | 12/69 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSAVDAIINYKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEA 65
|:..:|::....|..| :.|.|| :.::.:::...::.|||: .|.....|| :.||
Yeast 81 MTEPEALLILDISARE----INHLDE----KLLKKKHRKAMVRNHPDR-GGSPYMAAK---INEA 133
Fly 66 KETL 69
||.|
Yeast 134 KEVL 137
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
jdp | NP_651807.1 |
DnaJ |
17..79 |
CDD:278647 |
14/53 (26%) |
MDJ2 | NP_014071.1 |
DnaJ |
1..137 |
CDD:413365 |
17/67 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.