DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and MDJ2

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_014071.1 Gene:MDJ2 / 855388 SGDID:S000005272 Length:146 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:18/69 - (26%)
Similarity:33/69 - (47%) Gaps:12/69 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVDAIINYKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEA 65
            |:..:|::....|..|    :.|.||    :.::.:::...::.|||: .|.....||   :.||
Yeast    81 MTEPEALLILDISARE----INHLDE----KLLKKKHRKAMVRNHPDR-GGSPYMAAK---INEA 133

  Fly    66 KETL 69
            ||.|
Yeast   134 KEVL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 14/53 (26%)
MDJ2NP_014071.1 DnaJ 1..137 CDD:413365 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.