DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and DJP1

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_012269.1 Gene:DJP1 / 854820 SGDID:S000001443 Length:432 Species:Saccharomyces cerevisiae


Alignment Length:193 Identity:45/193 - (23%)
Similarity:82/193 - (42%) Gaps:15/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDKW 81
            ::|.||.....:|..:|:..|:..::|.|||||..|..|..:||.:.||.:.|.|.:.||.|||:
Yeast     6 EYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDLRAKYDKY 70

  Fly    82 ------RNSGISMSYKQWL------GMKEHVGQVRRYTIAEKVDKESMHWVTPKTKDRM--LPET 132
                  ...|...:.:|:.      ....::|::......:|.::.:......|.|:.:  :.|:
Yeast    71 GRKEAIPQGGFEDAAEQFSVIFGGDAFASYIGELMLLKNLQKTEELNAEDEAEKEKENVETMEES 135

  Fly   133 GGAAAQGPGTGAGCSSGGLTAASPNPAHRRASEGGAALYYGSRKGEW-GGENTDVANKFRNYE 194
            .........|.|..::.|.|....:....|.:.|...::.|::|.|. |.|......|...:|
Yeast   136 PADGKTNGTTNAVDAALGNTNEKDDKNKARTTSGNLTVHDGNKKNEQVGAEAKKKKTKLEQFE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 22/61 (36%)
DJP1NP_012269.1 PRK10767 7..>97 CDD:236757 27/89 (30%)
DnaJ-X 208..422 CDD:405064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.