DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and AT1G21080

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001185052.1 Gene:AT1G21080 / 838704 AraportID:AT1G21080 Length:400 Species:Arabidopsis thaliana


Alignment Length:134 Identity:39/134 - (29%)
Similarity:62/134 - (46%) Gaps:22/134 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDKW 81
            :||.:|.....::..:|:..|.:.|.|.|||||..|.:|...||.|.||.:.|.||.:|..||..
plant     6 EFYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSDPGQRQAYDTS 70

  Fly    82 RNSGISMS-------YKQWLG---MKEHVGQVRR--------YTIAEKVDK----ESMHWVTPKT 124
            ..||||..       :....|   .:|::||:..        :|..:::|.    |.|..|..:.
plant    71 GKSGISTEIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGDQIDTKKIIEKMRAVQKER 135

  Fly   125 KDRM 128
            :|::
plant   136 EDKL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 23/61 (38%)
AT1G21080NP_001185052.1 DnaJ 2..>95 CDD:223560 30/88 (34%)
DnaJ 6..68 CDD:278647 23/61 (38%)
DnaJ-X 132..312 CDD:291006 1/8 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.