DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and AT5G23590

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_197749.2 Gene:AT5G23590 / 832425 AraportID:AT5G23590 Length:296 Species:Arabidopsis thaliana


Alignment Length:154 Identity:39/154 - (25%)
Similarity:58/154 - (37%) Gaps:45/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFY---GLLHCDE--NSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRA 76
            |.|   ||...:|  ..:.::|...||:.||..||||...|.:|..|||:||.:.|.|.|.:.|.
plant     6 DHYIVLGLASGEEALKLTEKEIAKAYKLKALDLHPDKRPDDPDAHEKFQRLKTSYEVLKDEKARK 70

  Fly    77 IYDKWRNSGISMSYKQWLGMKEHVGQVRRYTIAEKVDKESMHWVTPKTKDRMLPETGGAAAQGPG 141
            ::|..........:|     |..|...||..:::..::|.                         
plant    71 LFDDLLRIQREKQHK-----KSQVDSKRRKMMSDLEERER------------------------- 105

  Fly   142 TGAGCSSGGLTAASPNPAHRRASE 165
                      :|.||||:.|...|
plant   106 ----------SAFSPNPSARAYDE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 25/66 (38%)
AT5G23590NP_197749.2 DnaJ 6..73 CDD:395170 25/66 (38%)
RRM_DNAJC17 173..245 CDD:409863
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.