DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and AT4G10130

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_192751.1 Gene:AT4G10130 / 826604 AraportID:AT4G10130 Length:174 Species:Arabidopsis thaliana


Alignment Length:83 Identity:29/83 - (34%)
Similarity:45/83 - (54%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDK------NSGDKEAEAKFQQLKEAKETLCDPE 73
            :|.:|.:|...|::|.|:|:..|:...|..||||      :|.|.|   ||.::::|.|.|.|.|
plant     9 HETYYEILSVKEDASYEEIRNSYRSAILHSHPDKLNNTSRSSSDDE---KFLKIQKAWEVLSDAE 70

  Fly    74 KRAIYD----KWRNSGIS 87
            .|.:||    ..|:.||:
plant    71 LRVVYDNDLRSSRHDGIT 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 23/67 (34%)
AT4G10130NP_192751.1 DnaJ 11..76 CDD:395170 23/67 (34%)
zf-CSL 90..164 CDD:419794
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.