DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and AT2G21510

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001324689.1 Gene:AT2G21510 / 816690 AraportID:AT2G21510 Length:353 Species:Arabidopsis thaliana


Alignment Length:127 Identity:41/127 - (32%)
Similarity:66/127 - (51%) Gaps:15/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDKW 81
            ::|.:|....::|..:|:..|.:.|.:.|||||.||.:|...||.|.||.:.|.:|:|||.|||:
plant     6 EYYEILGVKTDASDAEIKKAYYLKARKVHPDKNPGDPQAAKNFQVLGEAYQVLSNPDKRAAYDKY 70

  Fly    82 RNSGISMS--------YKQWLG---MKEHVGQVR-RYTIAEKVDKESMHWVTPKTKDRMLPE 131
            ...|:...        :....|   .:|:|||:. .|..:.:.|.|| |  .|:.:.:||.:
plant    71 GKEGVQQDAMVDPAAVFGMLFGSEVFEEYVGQLALAYLASIEADLES-H--DPEIRKQMLQD 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 24/61 (39%)
AT2G21510NP_001324689.1 PRK10767 7..>96 CDD:236757 29/88 (33%)
DnaJ-X 135..325 CDD:433858
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.