DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and dnajc12

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001314717.1 Gene:dnajc12 / 797196 ZFINID:ZDB-GENE-070801-3 Length:165 Species:Danio rerio


Alignment Length:193 Identity:70/193 - (36%)
Similarity:97/193 - (50%) Gaps:29/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDAIINYKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKET 68
            ::||:|.::...||:||||.|||.|:.|||..|:||.||..||||:..:.:|..:||:|:||||.
Zfish     1 MEAILNCRKEDLEDYYGLLGCDELSTTEQIVNEFKVKALACHPDKHPENPKAVEQFQKLQEAKEV 65

  Fly    69 LCDPEKRAIYDKWRNSGISMSYKQWLGMKEHVGQVRRYTIAEKVDKESMHWVTPKTKDRMLPETG 133
            |.|.:||..||.|..|.|.:.:.:|..:.:.|             |.||||.....|:.||.   
Zfish    66 LTDEKKRKSYDLWLRSQIKIPFGEWRALSDSV-------------KTSMHWAVKAKKEPMLE--- 114

  Fly   134 GAAAQGPGTGAGCSSGGLTAASPNPAHRRASEGGAALYYGSRKGEWGGE-NTDVANKFRNYEI 195
            .|....|      |........|:.|...:|:      |..::..|.|| .|.:..|||||||
Zfish   115 AAEDSNP------SDENTVQEKPSEASLPSSD------YWHQRFRWAGEAPTGLLQKFRNYEI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 33/61 (54%)
dnajc12NP_001314717.1 DnaJ 14..76 CDD:278647 33/61 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9437
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8492
Inparanoid 1 1.050 108 1.000 Inparanoid score I4892
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1499433at2759
OrthoFinder 1 1.000 - - FOG0006991
OrthoInspector 1 1.000 - - oto41047
orthoMCL 1 0.900 - - OOG6_107046
Panther 1 1.100 - - LDO PTHR44500
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4046
SonicParanoid 1 1.000 - - X5078
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.860

Return to query results.
Submit another query.