DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and Dnajc17

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_631878.2 Gene:Dnajc17 / 69408 MGIID:1916658 Length:303 Species:Mus musculus


Alignment Length:68 Identity:27/68 - (39%)
Similarity:38/68 - (55%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDKW 81
            |.|.||..:|.::.::::..|:..||..|||||..:..|...|.||.:|.|.|.|...||.|||.
Mouse    11 DLYALLGIEEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARAAYDKV 75

  Fly    82 RNS 84
            |.:
Mouse    76 RKA 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 23/61 (38%)
Dnajc17NP_631878.2 DnaJ 11..73 CDD:395170 23/61 (38%)
Smc <48..>159 CDD:440809 14/31 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..170
RRM_DNAJC17 184..247 CDD:409863
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.