powered by:
Protein Alignment jdp and Dnajc17
DIOPT Version :9
Sequence 1: | NP_651807.1 |
Gene: | jdp / 43630 |
FlyBaseID: | FBgn0027654 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_631878.2 |
Gene: | Dnajc17 / 69408 |
MGIID: | 1916658 |
Length: | 303 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 27/68 - (39%) |
Similarity: | 38/68 - (55%) |
Gaps: | 0/68 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDKW 81
|.|.||..:|.::.::::..|:..||..|||||..:..|...|.||.:|.|.|.|...||.|||.
Mouse 11 DLYALLGIEEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARAAYDKV 75
Fly 82 RNS 84
|.:
Mouse 76 RKA 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.