DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and zgc:122979

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001032663.2 Gene:zgc:122979 / 641576 ZFINID:ZDB-GENE-051127-45 Length:360 Species:Danio rerio


Alignment Length:64 Identity:34/64 - (53%)
Similarity:47/64 - (73%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDK 80
            |:|.:|....:|:.|:|:..||.|||:||||||| |.:||.||:|:.:|.:.|.|||||.|||:
Zfish    51 DYYSVLGVSNDSNEEEIRKAYKRLALRYHPDKNS-DADAEDKFKQIAQAYDVLTDPEKRNIYDQ 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 32/61 (52%)
zgc:122979NP_001032663.2 DnaJ_bact 51..354 CDD:274090 34/64 (53%)

Return to query results.
Submit another query.