DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and Dnajc12

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001029204.1 Gene:Dnajc12 / 619393 RGDID:1591898 Length:198 Species:Rattus norvegicus


Alignment Length:234 Identity:78/234 - (33%)
Similarity:104/234 - (44%) Gaps:78/234 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDAIINYKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKET 68
            :|||:||:...:||:|.||.|||.||.|||.||:||.||:.||||:..:.:|...||:|::|||.
  Rat     1 MDAILNYRPEGSEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENSKAVETFQKLQKAKEI 65

  Fly    69 LCDPEKRAIYDKWRNSGISMSYKQWLGMKEHVGQVRRYTIAEKVDKESMHWVTPKTKDRML---- 129
            |.:.|.||.||.||.|.:|||::||..:.:.|             |.||||.....||.||    
  Rat    66 LSNAESRARYDHWRRSQMSMSFEQWEALADSV-------------KTSMHWAVRSKKDLMLEGSE 117

  Fly   130 -------------------------------------PETGGAAAQGPGTGAGCSSGGLTAASPN 157
                                                 ||. |.:.|.|      .|.||:..:..
  Rat   118 QTYTNTAQNKERSEQRETKQGDPDSTPEKMMQKESESPEK-GISPQNP------DSPGLSDWNCG 175

  Fly   158 PAHRRASEGGAALYYGSRKGEWGGEN-TDVANKFRNYEI 195
            ..|.|                |.|:. :::..|||||||
  Rat   176 HLHFR----------------WSGDTPSELLRKFRNYEI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 33/61 (54%)
Dnajc12NP_001029204.1 DnaJ 14..76 CDD:278647 33/61 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..183 11/84 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9458
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8492
Inparanoid 1 1.050 113 1.000 Inparanoid score I4763
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1499433at2759
OrthoFinder 1 1.000 - - FOG0006991
OrthoInspector 1 1.000 - - oto96445
orthoMCL 1 0.900 - - OOG6_107046
Panther 1 1.100 - - LDO PTHR44500
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5078
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.