DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and Dnajc4

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001343928.1 Gene:Dnajc4 / 57431 MGIID:1927346 Length:261 Species:Mus musculus


Alignment Length:69 Identity:21/69 - (30%)
Similarity:36/69 - (52%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKR 75
            :||...::|.||.....:|.|:|:..:...:.:.|||::.|:....::|.:|.||...|...|.|
Mouse    47 QRSVPTNYYELLGVHPGASAEEIKRAFFTKSKELHPDRDPGNPALHSRFVELNEAYRVLSREESR 111

  Fly    76 AIYD 79
            ..||
Mouse   112 RNYD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 17/61 (28%)
Dnajc4NP_001343928.1 DnaJ 53..>157 CDD:440252 19/63 (30%)

Return to query results.
Submit another query.