DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and dnajb5

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001093510.1 Gene:dnajb5 / 569466 ZFINID:ZDB-GENE-070705-308 Length:360 Species:Danio rerio


Alignment Length:92 Identity:34/92 - (36%)
Similarity:52/92 - (56%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDK 80
            :|:|.:|.....|:.::|:..|:.:||::|||||. |..||.||:::.||.|.|.||:||.|||:
Zfish     3 KDYYKILGIPSGSNEDEIKKAYRKMALKFHPDKNK-DPNAEEKFKEIAEAYEVLSDPKKRVIYDQ 66

  Fly    81 WRNSGISMSYKQWLGMKEHVGQVRRYT 107
            :...|:...   ..|.....|....||
Zfish    67 YGEDGLKTG---GTGSSSGQGTTYHYT 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 27/61 (44%)
dnajb5NP_001093510.1 DnaJ_bact 4..355 CDD:274090 34/91 (37%)

Return to query results.
Submit another query.