DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and DNAJC12

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_068572.1 Gene:DNAJC12 / 56521 HGNCID:28908 Length:198 Species:Homo sapiens


Alignment Length:211 Identity:73/211 - (34%)
Similarity:102/211 - (48%) Gaps:32/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VDAIINYKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKET 68
            :|||:||:....||:|.||.|||.||.|||.||:||.||:.||||:..:.:|...||:|::|||.
Human     1 MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEI 65

  Fly    69 LCDPEKRAIYDKWRNSGISMSYKQWLGMKEHVGQVRRYTIAEKVDKESMHWVTPKTKDRMLPETG 133
            |.:.|.||.||.||.|.:||.::||..:.:.|             |.|||||....||.||.|:.
Human    66 LTNEESRARYDHWRRSQMSMPFQQWEALNDSV-------------KTSMHWVVRGKKDLMLEESD 117

  Fly   134 ------------GAAAQGPGTGAGCSSGGLTAASPNPAHRRA------SEGGAALYYGSRKGEWG 180
                        ....:........::.......|.|..:..      |.|.|.:.....:..|.
Human   118 KTHTTKMENEECNEQRERKKEELASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWS 182

  Fly   181 GE-NTDVANKFRNYEI 195
            .: .:::..|||||||
Human   183 KDAPSELLRKFRNYEI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 33/61 (54%)
DNAJC12NP_068572.1 CbpA 9..>164 CDD:225124 57/167 (34%)
DnaJ 14..76 CDD:306689 33/61 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..169 4/54 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8492
Inparanoid 1 1.050 112 1.000 Inparanoid score I4859
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1499433at2759
OrthoFinder 1 1.000 - - FOG0006991
OrthoInspector 1 1.000 - - oto89321
orthoMCL 1 0.900 - - OOG6_107046
Panther 1 1.100 - - LDO PTHR44500
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4046
SonicParanoid 1 1.000 - - X5078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.