DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and DNAJC17

DIOPT Version :9

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_016877890.1 Gene:DNAJC17 / 55192 HGNCID:25556 Length:308 Species:Homo sapiens


Alignment Length:83 Identity:30/83 - (36%)
Similarity:41/83 - (49%) Gaps:7/83 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAVDAIINYKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAK 66
            |:|.:.:.:...|.|.      |..:|| .|::..|:..||..|||||..:..|...|.||.:|.
Human     7 SSVCSSLTFHLKPFEG------CVAHSS-WQVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQAL 64

  Fly    67 ETLCDPEKRAIYDKWRNS 84
            |.|.|...||.|||.|.:
Human    65 EVLTDAAARAAYDKVRKA 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:278647 22/61 (36%)
DNAJC17XP_016877890.1 DnaJ <30..77 CDD:278647 19/46 (41%)
RRM_DNAJC17 188..251 CDD:240875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2214
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.