powered by:
Protein Alignment jdp and CG6693
DIOPT Version :9
Sequence 1: | NP_651807.1 |
Gene: | jdp / 43630 |
FlyBaseID: | FBgn0027654 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262473.1 |
Gene: | CG6693 / 41346 |
FlyBaseID: | FBgn0037878 |
Length: | 299 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 39/66 - (59%) |
Gaps: | 2/66 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 DFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEA--KFQQLKEAKETLCDPEKRAIYD 79
|.|.|:.....:..::::..|..|:|..|||:...:::||: ||:.|.:..:.|.|.:|||:||
Fly 15 DVYKLMELARGAGEKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVLTDTQKRALYD 79
Fly 80 K 80
:
Fly 80 E 80
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
jdp | NP_651807.1 |
DnaJ |
17..79 |
CDD:278647 |
19/63 (30%) |
CG6693 | NP_001262473.1 |
DnaJ |
15..79 |
CDD:278647 |
19/63 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2214 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.