DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and DNAJB13

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:61 Identity:26/61 - (42%)
Similarity:38/61 - (62%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDKWRNSGI 86
            |:|:.|.....|:.|||::||.|::....||. |:|:.||.:.|.||.||.||||:...|:
Human    47 EHSTAEDKDQRYRRLALKHHPLKSNEPSSAEI-FRQIAEAYDVLSDPMKRGIYDKFGEEGL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 22/52 (42%)
DNAJB13XP_011543306.1 PTZ00037 42..345 CDD:240236 26/61 (43%)

Return to query results.
Submit another query.