DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jdp and Dnajc24

DIOPT Version :10

Sequence 1:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:117 Identity:28/117 - (23%)
Similarity:54/117 - (46%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YKRSPNEDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGD------KEAEAKFQQLKEAKET 68
            ::::..:|:|.:|..|.::....::.:|:.|.|.|||||.|.|      :|...||.::.:|.:.
  Rat     3 FEQTVKKDWYSILGADPSADVSDLKQKYQKLILLYHPDKQSADVPAGTMEECVQKFIEIDQAWKI 67

  Fly    69 LCDPEKRAIYDKWRNSGISMSYKQWLGMKEHVGQVRRY-TIAEKVDKESMHW 119
            |.:.|.:..||                ::.|..::|.. .:..:|..|.|.|
  Rat    68 LGNEETKKKYD----------------LQRHEDELRNVGPVDAQVHLEEMSW 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jdpNP_651807.1 DnaJ 17..79 CDD:395170 20/67 (30%)
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 20/67 (30%)
zf-CSL 94..147 CDD:398744 4/10 (40%)

Return to query results.
Submit another query.